KEGG   Streptomyces venezuelae: SVEN_1722Help
Entry
SVEN_1722         CDS       T02274                                 

Definition
putative secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sve00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sve00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sve02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1920240..1921889
Genome map
AA seq 549 aa AA seqDB search
MTSRFISSAPTRRTVVKAAAVTAVTAPALLGAASTAHAGSGAPAFLHGVASGDPLPDGVL
LWTRVTPTPEAVPGSGLGPDVQVDWELAEDRSFGRVVASGTTTASAGSDHTVKADVRGLR
PATSYWFRFTAGSAVSPAAHTRTAPAADATAPGVRFGVVSCANWEAGHFAAYRHLAARAD
LDAILHLGDYVYEYGSGTYPAAEYTVRQHEPRHEIVSLADYRTRHGHYKTDPDLQALHAA
HPFVAIWDDHEFANDAWTGGAENHTPGAEGDWAARVAAAKQAYFEWMPVRTSTEGTVFRR
LRFGKLADLHLLDLRSFRSAPAKTGSGSVDDPERSITGRAQLDWLKSGLAGSDATWQLVG
TSVMISPVAFGALPAHLLEPIAELMGLPKEGLAVNVDQWDGYTDDRKELLGHLTSRAIRN
TVFLTGDIHMAWANDVPVKAATYPFSASAATEFVVTSVTSDNLDDLLHVAPGTLSVVAAG
AVKAANRHVKWVDMDHHGYGVLDVTAERSQMDYYTVSDKADPGATTAWARSYRTLSGTQR
VERVYQPVH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcgtttcatatcctccgcccccacgcggcgcacggtcgtcaaggccgccgcc
gtcaccgccgtcaccgcgcccgccctcctcggcgcggcctccacggcccacgccggctcc
ggggcgcccgcgttcctccacggcgtcgcctccggcgacccgctgcccgacggcgtcctg
ctctggacgcgcgtcacccccacccccgaggccgtgcccggctccggcctcggccccgac
gtccaggtcgactgggagctcgccgaggaccgctccttcggccgggtcgtcgcctccggc
acgaccacggcgagcgccggctccgaccacacggtcaaggccgacgtccgcggcctgcgc
ccggccacctcctactggttccgcttcaccgcgggctccgccgtctcccccgccgcgcac
acccgcaccgccccggccgccgacgccacggcgcccggcgtgcgcttcggcgtggtctcc
tgcgccaactgggaggccggccacttcgccgcgtaccgccatctcgccgcccgcgccgac
ctggacgcgatcctgcacctcggcgactacgtgtacgagtacggcagcggcacctacccg
gcggccgagtacaccgtccggcagcacgagccgcgccacgagatcgtctccctggccgat
taccgcacccggcacggccactacaagacggatcccgacctccaggcgctgcacgcggcc
cacccgttcgtcgccatctgggacgaccacgagttcgccaacgacgcctggacgggcggg
gccgagaaccacacccccggcgccgagggcgactgggcggcccgggtcgccgccgccaag
caggcgtacttcgagtggatgccggtccgcacctccacggagggcacggtcttccgccgg
ctgcgcttcggcaagctggccgatctgcacctgctcgacctgcgttccttccgttccgcc
ccggcgaagacgggcagcggctcggtcgacgacccggagcggagcatcaccgggcgcgcc
cagctcgactggctgaagtccggtctggccggctcggacgcgacctggcagctggtcggc
acctcggtgatgatctcgccggtcgccttcggcgcgctgcccgcccacctcctggagccg
atcgccgagctgatgggcctgccgaaggaggggctcgcggtcaacgtcgaccagtgggac
ggctacacggacgaccgcaaggagctgctcgggcacctgacctcgcgggcgatccgcaac
acggtcttcctgaccggtgacatccacatggcctgggccaacgacgtaccggtgaaggcg
gcgacgtaccccttctcggcgtccgccgcgaccgagttcgtggtcacctcggtgacctcg
gacaacctggacgacctgctgcacgtggcgccggggacgctctcggtggtggccgcgggc
gcggtcaaggccgccaaccggcacgtgaagtgggtggacatggaccaccacggctacggc
gtcctggacgtgaccgccgagcgctcgcagatggactactacacggtctccgacaaggcg
gacccgggcgcgacgacggcgtgggcgcgctcgtaccggacgctcagcggaacgcagcgt
gtcgagcgggtgtaccagcccgtccactga

DBGET integrated database retrieval system