KEGG   Streptomyces venezuelae: SVEN_1722Help
Entry
SVEN_1722         CDS       T02274                                 

Definition
putative secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SVEN_1722
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SVEN_1722
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SVEN_1722
Enzymes [BR:sve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SVEN_1722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1920240..1921889
Genome map
AA seq 549 aa AA seqDB search
MTSRFISSAPTRRTVVKAAAVTAVTAPALLGAASTAHAGSGAPAFLHGVASGDPLPDGVL
LWTRVTPTPEAVPGSGLGPDVQVDWELAEDRSFGRVVASGTTTASAGSDHTVKADVRGLR
PATSYWFRFTAGSAVSPAAHTRTAPAADATAPGVRFGVVSCANWEAGHFAAYRHLAARAD
LDAILHLGDYVYEYGSGTYPAAEYTVRQHEPRHEIVSLADYRTRHGHYKTDPDLQALHAA
HPFVAIWDDHEFANDAWTGGAENHTPGAEGDWAARVAAAKQAYFEWMPVRTSTEGTVFRR
LRFGKLADLHLLDLRSFRSAPAKTGSGSVDDPERSITGRAQLDWLKSGLAGSDATWQLVG
TSVMISPVAFGALPAHLLEPIAELMGLPKEGLAVNVDQWDGYTDDRKELLGHLTSRAIRN
TVFLTGDIHMAWANDVPVKAATYPFSASAATEFVVTSVTSDNLDDLLHVAPGTLSVVAAG
AVKAANRHVKWVDMDHHGYGVLDVTAERSQMDYYTVSDKADPGATTAWARSYRTLSGTQR
VERVYQPVH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcgtttcatatcctccgcccccacgcggcgcacggtcgtcaaggccgccgcc
gtcaccgccgtcaccgcgcccgccctcctcggcgcggcctccacggcccacgccggctcc
ggggcgcccgcgttcctccacggcgtcgcctccggcgacccgctgcccgacggcgtcctg
ctctggacgcgcgtcacccccacccccgaggccgtgcccggctccggcctcggccccgac
gtccaggtcgactgggagctcgccgaggaccgctccttcggccgggtcgtcgcctccggc
acgaccacggcgagcgccggctccgaccacacggtcaaggccgacgtccgcggcctgcgc
ccggccacctcctactggttccgcttcaccgcgggctccgccgtctcccccgccgcgcac
acccgcaccgccccggccgccgacgccacggcgcccggcgtgcgcttcggcgtggtctcc
tgcgccaactgggaggccggccacttcgccgcgtaccgccatctcgccgcccgcgccgac
ctggacgcgatcctgcacctcggcgactacgtgtacgagtacggcagcggcacctacccg
gcggccgagtacaccgtccggcagcacgagccgcgccacgagatcgtctccctggccgat
taccgcacccggcacggccactacaagacggatcccgacctccaggcgctgcacgcggcc
cacccgttcgtcgccatctgggacgaccacgagttcgccaacgacgcctggacgggcggg
gccgagaaccacacccccggcgccgagggcgactgggcggcccgggtcgccgccgccaag
caggcgtacttcgagtggatgccggtccgcacctccacggagggcacggtcttccgccgg
ctgcgcttcggcaagctggccgatctgcacctgctcgacctgcgttccttccgttccgcc
ccggcgaagacgggcagcggctcggtcgacgacccggagcggagcatcaccgggcgcgcc
cagctcgactggctgaagtccggtctggccggctcggacgcgacctggcagctggtcggc
acctcggtgatgatctcgccggtcgccttcggcgcgctgcccgcccacctcctggagccg
atcgccgagctgatgggcctgccgaaggaggggctcgcggtcaacgtcgaccagtgggac
ggctacacggacgaccgcaaggagctgctcgggcacctgacctcgcgggcgatccgcaac
acggtcttcctgaccggtgacatccacatggcctgggccaacgacgtaccggtgaaggcg
gcgacgtaccccttctcggcgtccgccgcgaccgagttcgtggtcacctcggtgacctcg
gacaacctggacgacctgctgcacgtggcgccggggacgctctcggtggtggccgcgggc
gcggtcaaggccgccaaccggcacgtgaagtgggtggacatggaccaccacggctacggc
gtcctggacgtgaccgccgagcgctcgcagatggactactacacggtctccgacaaggcg
gacccgggcgcgacgacggcgtgggcgcgctcgtaccggacgctcagcggaacgcagcgt
gtcgagcgggtgtaccagcccgtccactga

DBGET integrated database retrieval system