KEGG   Streptomyces venezuelae: SVEN_1783Help
Entry
SVEN_1783         CDS       T02274                                 

Definition
putative esterase or lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sve  Streptomyces venezuelae
Brite
Enzymes [BR:sve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SVEN_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1988629..1989318
Genome map
AA seq 229 aa AA seqDB search
MRPWAEFLAARGLTVSVPLLPGHGTRWQDMQLTTWRDWYAEVDRALSELLERCATVFVFG
LSMGGALALRLAAKHGDAVKGVVLVNPGNKVHGLAAYALPVVRHLVPSTKGIASDIAKEG
VTEIGYDRVPLHSAHSLRHFFRTVDAELPQVTQPVVLLHSPQDHVVPPADSARILSRISS
TDVKEILLEQSYHVATLDHDAERIFDESLAFVERLAPGLVDEQGSRSGG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccgtgggccgagttcctggccgcccgcggcctgacggtgtcggtgcccctgctg
cccggccacggcacccgctggcaggacatgcagctcaccacctggcgcgactggtacgcg
gaggtggaccgggccctgagcgagctcctggagcggtgcgcgaccgtgttcgtcttcggc
ctctccatgggcggggcgctcgccctgcggctcgccgcgaagcacggggacgccgtgaag
ggcgtcgtcctggtcaacccgggcaacaaggtgcacggcctcgcggcgtacgccctgccg
gtcgtccgccacctggtcccctccaccaagggcatcgcgagcgacatcgccaaggagggc
gtgaccgagatcggctacgaccgggtgccgctgcactcggcgcactccctgcgccacttc
ttccggaccgtggacgcggagctcccacaggtcacacagccggtggtactgctccacagc
ccccaggaccacgtcgtgccgccggccgactcggcccggatcctctcccggatctcctcg
acggacgtcaaggagatcctgctggaacagagctaccacgtggcgacgttggaccatgac
gcggagcggatcttcgacgagagcctggccttcgtcgagcgtctcgccccgggactggtc
gacgagcaggggagcaggagcggtggctga

DBGET integrated database retrieval system