KEGG   Streptomyces venezuelae: SVEN_1786Help
Entry
SVEN_1786         CDS       T02274                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sve  Streptomyces venezuelae
Pathway
sve00010  Glycolysis / Gluconeogenesis
sve00052  Galactose metabolism
sve00500  Starch and sucrose metabolism
sve00520  Amino sugar and nucleotide sugar metabolism
sve00521  Streptomycin biosynthesis
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_1786
   00052 Galactose metabolism
    SVEN_1786
   00500 Starch and sucrose metabolism
    SVEN_1786
   00520 Amino sugar and nucleotide sugar metabolism
    SVEN_1786
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SVEN_1786
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SVEN_1786
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SVEN_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hydant_A_N FGGY_N DEDD_Tnp_IS110 FtsA
Motif
Other DBs
NCBI-ProteinID: CCA55073
UniProt: F2RI90
Position
complement(1990876..1991817)
Genome map
AA seq 313 aa AA seqDB search
MGLTIGVDIGGTKIAAGVVDEEGNILDTHKVPTPPTPEGIVDAISAAVSEAGKGHSIEAV
GIGAAGYVDDKRATVLFAPNIDWRHEPLKDKVEQRVGLPVVVENDANAAAWGEYKFGAGK
GHEDVICITLGTGLGGGIIIGNKLRRGRFGVAAEFGHIRVVPDGLLCGCGSQGCWEQYAS
GRALVRYAKQRANATPERAEVLLGLGDGTPEGIEGRHVSQAARAGDPVAIDSFRELARWA
GAGLADLASLFDPSAFIVGGGVSDEGDLVLDPIRKSFRRWLIGGQWRPHAQVLAAQLGNK
AGLVGAADLARQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgacatcggcggcacgaagatcgcggccggcgtggtcgac
gaggagggcaacatcctcgacacgcacaaggtgcccaccccgccgacccccgagggcatc
gtcgacgcgatcagcgccgctgtgtccgaggccggcaagggccactcgatcgaggccgtc
ggcatcggggccgcgggctacgtcgacgacaagcgtgccaccgtcctcttcgcgccgaac
atcgactggcggcacgagccgctcaaggacaaggtcgagcagcgggtcggcctccccgtc
gtcgtcgagaacgacgccaacgcggcggcctggggcgagtacaagttcggcgccggcaag
ggccacgaggacgtcatctgcatcaccctcggcaccggcctcggcggcggcatcatcatc
ggcaacaagctgcgccgcggacgcttcggcgtcgccgccgagttcggccacatccgggtg
gtcccggacggcctgctgtgcggctgcggcagccagggctgctgggagcagtacgcctcc
gggcgcgccctcgtgcggtacgccaagcagcgcgccaacgccacccccgagcgggccgag
gtcctcctcgggctcggcgacggcacccccgagggcatcgagggccgtcacgtcagccag
gccgcccgcgcgggcgacccggtcgccatcgactccttccgcgagctggcccgctgggcc
ggggccggcctcgcggacctggcctcgctcttcgacccctcggcgttcatcgtcggcggc
ggcgtctcggacgagggcgacctggtcctcgacccgatccgcaagtccttccggcgctgg
ctgatcggcggtcagtggcgcccgcacgcccaggtcctggcggcccagctcggcaacaag
gccggtctcgtcggcgccgcggacctcgcccgccagggctga

DBGET integrated database retrieval system