KEGG   Streptomyces venezuelae: SVEN_1843Help
Entry
SVEN_1843         CDS       T02274                                 

Definition
Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sve  Streptomyces venezuelae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_1843
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVEN_1843
  Amino acid metabolism
   00310 Lysine degradation
    SVEN_1843
Enzymes [BR:sve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SVEN_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2054006..2055796
Genome map
AA seq 596 aa AA seqDB search
MSVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPASGILASIK
VAEDETVEVGAELAIIDDGSGAPAAAPAPAAEAAPAPAAAPAPQAAPSTEVQEPAPAPTA
EAAAGGGSAEGTDVVLPALGESVTEGTVTRWLKSVGETVEADEPLLEVSTDKVDTEIPAP
ASGVLLEIVVAEDETAEVGAKLAVIGAAGAAPAAAPAAAPAAPAAAPAPAAPAPAAAAPA
PAAPAAPAPAPAPAAPAAPAPAAQAPSIAPAVVTPVPAAPAAPAAPAEDGAYVTPLVRKL
ATENGVDLAAVKGSGVGGRIRKQDVLAAAEAKKTAAAPAAAAPAAAAKAPALEVSPLRGQ
TVKMTRMRKVIGDNMMKALHGQAQLTSVVEVDITKLMKLRARAKDAFAAREGVKLSPMPF
FVKAAAQALKAHPVINARINEDEGTITYFDTENIGIAVDSEKGLMTPVIKGAGDLNIAGI
SKKTAELAGAVRASKITPDDLAGATFTISNTGSRGALFDTIIVPPNQVAILGIGATVRRP
VVINHPDLGETIAIRDMTYVALSYDHRLVDGADAARYLTSVKAILEAGEFEVDLGL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttccgtaaccctgccggcgctcggcgagagcgtcaccgagggcaccgtcacc
cgctggctcaaggccgagggtgagcgtgtcgaggccgacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatccccgcccccgcctcgggcatcctggcctccatcaag
gtcgccgaggacgagacggtcgaggtcggcgccgagctggccatcatcgacgacggctcc
ggcgctcccgccgcggcccccgccccggccgccgaggccgcgccggctccggccgccgcc
ccggcgccgcaggccgccccgtccaccgaggtccaggagccggctccggccccgacggcc
gaggcggccgccggcggcggttccgccgagggcaccgacgtcgtgctgccggcgctcggc
gagtccgtcaccgagggcaccgtgacccgctggctgaagtcggtcggcgagaccgtcgag
gccgacgagccgctgctcgaggtctccacggacaaggtcgacaccgagatccccgccccg
gcctccggcgttctcctggagatcgtcgtcgccgaggacgagaccgccgaggtcggcgcc
aagctcgccgtcatcggtgccgcgggtgccgctccggcggccgccccggccgcggctccg
gccgcccccgccgccgctccggctccggccgctccggccccggccgccgctgctccggcc
ccggccgccccggccgctccggctccggcccccgcgccggccgcccccgccgctccggcg
ccggccgcgcaggccccgtcgatcgccccggcggtcgtcaccccggttccggcggccccc
gcggccccggccgcgcccgcggaggacggcgcgtacgtgaccccgctggtccgcaagctc
gccaccgagaacggtgtcgacctggcggccgtcaagggctccggcgtcggtggccggatc
cgcaagcaggacgtcctcgcggccgccgaggccaagaagaccgccgccgccccggccgcg
gccgctccggccgccgccgccaaggctccggccctggaggtctccccgctgcgcggtcag
accgtcaagatgacccgcatgcgcaaggtcatcggcgacaacatgatgaaggcgctgcac
ggccaggcccagctgacctcggtcgtcgaggtcgacatcaccaagctgatgaagctgcgc
gcccgcgcgaaggacgccttcgccgcccgtgagggcgtcaagctgtccccgatgccgttc
ttcgtgaaggcggcggcccaggcgctgaaggcccacccggtcatcaacgcccggatcaac
gaggacgagggcacgatcacctacttcgacaccgagaacatcggtatcgcggtggactcc
gagaagggtctgatgaccccggtcatcaagggtgcgggcgacctcaacatcgccggcatc
tcgaagaagaccgcggagctggccggcgccgtgcgcgccagcaagatcacgccggacgac
ctcgccggtgcgaccttcaccatctccaacaccggttcgcgcggcgcgctcttcgacacg
atcatcgtgccgccgaaccaggtcgccatcctgggcatcggcgccaccgtgcgccgtccg
gtcgtcatcaaccacccggacctgggtgagacgatcgcgatccgcgacatgacgtacgtc
gcgctgtcctacgaccaccgtctggtggacggcgccgacgccgcccgctacctgacctcg
gtcaaggcgatcctggaggccggcgagttcgaggtcgacctcggcctgtaa

DBGET integrated database retrieval system