KEGG   Streptomyces venezuelae: SVEN_1843Help
Entry
SVEN_1843         CDS       T02274                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sve  Streptomyces venezuelae
Pathway
sve00020  Citrate cycle (TCA cycle)
sve00310  Lysine degradation
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01200  Carbon metabolism
Module
sve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVEN_1843
  Amino acid metabolism
   00310 Lysine degradation
    SVEN_1843
Enzymes [BR:sve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SVEN_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CCA55130
UniProt: F2RJC0
Position
2054006..2055796
Genome map
AA seq 596 aa AA seqDB search
MSVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPASGILASIK
VAEDETVEVGAELAIIDDGSGAPAAAPAPAAEAAPAPAAAPAPQAAPSTEVQEPAPAPTA
EAAAGGGSAEGTDVVLPALGESVTEGTVTRWLKSVGETVEADEPLLEVSTDKVDTEIPAP
ASGVLLEIVVAEDETAEVGAKLAVIGAAGAAPAAAPAAAPAAPAAAPAPAAPAPAAAAPA
PAAPAAPAPAPAPAAPAAPAPAAQAPSIAPAVVTPVPAAPAAPAAPAEDGAYVTPLVRKL
ATENGVDLAAVKGSGVGGRIRKQDVLAAAEAKKTAAAPAAAAPAAAAKAPALEVSPLRGQ
TVKMTRMRKVIGDNMMKALHGQAQLTSVVEVDITKLMKLRARAKDAFAAREGVKLSPMPF
FVKAAAQALKAHPVINARINEDEGTITYFDTENIGIAVDSEKGLMTPVIKGAGDLNIAGI
SKKTAELAGAVRASKITPDDLAGATFTISNTGSRGALFDTIIVPPNQVAILGIGATVRRP
VVINHPDLGETIAIRDMTYVALSYDHRLVDGADAARYLTSVKAILEAGEFEVDLGL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttccgtaaccctgccggcgctcggcgagagcgtcaccgagggcaccgtcacc
cgctggctcaaggccgagggtgagcgtgtcgaggccgacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatccccgcccccgcctcgggcatcctggcctccatcaag
gtcgccgaggacgagacggtcgaggtcggcgccgagctggccatcatcgacgacggctcc
ggcgctcccgccgcggcccccgccccggccgccgaggccgcgccggctccggccgccgcc
ccggcgccgcaggccgccccgtccaccgaggtccaggagccggctccggccccgacggcc
gaggcggccgccggcggcggttccgccgagggcaccgacgtcgtgctgccggcgctcggc
gagtccgtcaccgagggcaccgtgacccgctggctgaagtcggtcggcgagaccgtcgag
gccgacgagccgctgctcgaggtctccacggacaaggtcgacaccgagatccccgccccg
gcctccggcgttctcctggagatcgtcgtcgccgaggacgagaccgccgaggtcggcgcc
aagctcgccgtcatcggtgccgcgggtgccgctccggcggccgccccggccgcggctccg
gccgcccccgccgccgctccggctccggccgctccggccccggccgccgctgctccggcc
ccggccgccccggccgctccggctccggcccccgcgccggccgcccccgccgctccggcg
ccggccgcgcaggccccgtcgatcgccccggcggtcgtcaccccggttccggcggccccc
gcggccccggccgcgcccgcggaggacggcgcgtacgtgaccccgctggtccgcaagctc
gccaccgagaacggtgtcgacctggcggccgtcaagggctccggcgtcggtggccggatc
cgcaagcaggacgtcctcgcggccgccgaggccaagaagaccgccgccgccccggccgcg
gccgctccggccgccgccgccaaggctccggccctggaggtctccccgctgcgcggtcag
accgtcaagatgacccgcatgcgcaaggtcatcggcgacaacatgatgaaggcgctgcac
ggccaggcccagctgacctcggtcgtcgaggtcgacatcaccaagctgatgaagctgcgc
gcccgcgcgaaggacgccttcgccgcccgtgagggcgtcaagctgtccccgatgccgttc
ttcgtgaaggcggcggcccaggcgctgaaggcccacccggtcatcaacgcccggatcaac
gaggacgagggcacgatcacctacttcgacaccgagaacatcggtatcgcggtggactcc
gagaagggtctgatgaccccggtcatcaagggtgcgggcgacctcaacatcgccggcatc
tcgaagaagaccgcggagctggccggcgccgtgcgcgccagcaagatcacgccggacgac
ctcgccggtgcgaccttcaccatctccaacaccggttcgcgcggcgcgctcttcgacacg
atcatcgtgccgccgaaccaggtcgccatcctgggcatcggcgccaccgtgcgccgtccg
gtcgtcatcaaccacccggacctgggtgagacgatcgcgatccgcgacatgacgtacgtc
gcgctgtcctacgaccaccgtctggtggacggcgccgacgccgcccgctacctgacctcg
gtcaaggcgatcctggaggccggcgagttcgaggtcgacctcggcctgtaa

DBGET integrated database retrieval system