KEGG   Streptomyces venezuelae: SVEN_2548Help
Entry
SVEN_2548         CDS       T02274                                 

Definition
Beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sve  Streptomyces venezuelae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SVEN_2548
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SVEN_2548
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SVEN_2548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2768906..2770687
Genome map
AA seq 593 aa AA seqDB search
MTAAAAAAAVTGFATPAHAGQDRHDDRKLRRIIDRMSLEEKVGQLFVMRVYGHSATAPDQ
ADIDANLQDIGVRTAAELVERYHVGGVIYFSWAHNTRDPRQIAELSNGIQQAALAQPTPV
PALISTDQEHGIVCRVGEPAALLPGAMALGAGGSRADARRAAQIAGEELAAVGIRQNYAP
VADVNVNPANPVIGVRSFGSDPAAVAGLVAAQVTGYQRAGVAATSKHFPGHGDTTVDSHV
GLPTISHTRAQWSELDAPPFRSAIAAGIDSIMTAHIVVPALDPSGDPATLSRPILTGILR
EELGYDGVVVTDSLGMEGVRTRYGDERVPVLALKAGVDQLLNPPKLDVAWNAVLRAVRDG
ELTEARLDESILRILRLKAKLGLFRRAYVSRAGVDRVVGSAAHLAQADRIAEATTTLLRN
EGGFLPLNPARHGSVLVVGADPASPSGTTGPPTTTLATALTELGFTATALSTGISPTAAR
IEEAVAAAAGKDVVVVGTYNVTGASPQRTLVARLVATGVPVVTVAIRNPYDIAWLEGQRA
TLATYSWTDVELRAAVRVLAGRARPRGRLPVPVQDAEEPAKVLHPVGYGLSYR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgccgcggcagcggccgccgtcaccgggttcgccacccccgcccacgccggg
caggaccggcacgacgaccggaagctccggcggatcatcgaccgcatgtccctcgaggag
aaggtcggccagctcttcgtgatgcgggtgtacggccactccgcgaccgcccccgaccag
gccgacatcgacgccaacctccaggacatcggcgtccgcaccgccgccgagctggtcgag
cgctaccacgtgggcggcgtcatctacttctcctgggcccacaacacccgcgacccgcgg
cagatcgccgagctctccaacggcatccagcaggccgcgctcgcccagcccacgccggtc
cccgcgctgatctccaccgaccaggagcacggcatcgtctgccgggtcggcgagcccgcc
gccctgctgcccggggcgatggccctcggcgccggcggttcgcgggcggacgcccgcagg
gccgcgcagatcgcgggcgaggagctcgcggccgtcggcatccggcagaactacgcgccg
gtcgcggacgtcaacgtcaacccggccaacccggtcatcggcgtccgctccttcggctcg
gacccggcggccgtcgccggcctggtcgccgcgcaggtcacggggtaccagcgggccggg
gtcgcggccacctccaagcacttccccgggcacggcgacaccaccgtcgacagccatgtc
ggactgccgacgatcagccacacgcgggcgcagtggagcgagctggacgcgccgccgttc
cggtccgcgatcgccgccgggatcgactcgatcatgaccgcgcacatcgtggtcccggcg
ctcgacccgagcggggacccggcgacgctgtcccggccgatcctcaccggcatcctccgc
gaggagctgggctacgacggcgtcgtggtcaccgactcgctcgggatggagggggtgcgc
acccggtacggcgacgagcgcgtcccggtcctcgccctgaaggccggggtggaccagctg
ctgaacccgccgaagctcgacgtggcgtggaacgcggtcctgagggcggtgcgggacggc
gagctgacggaggcccggctcgacgaatcgatcctgcggatcctgcggctcaaggcgaag
ctcggtctgttccggcgggcgtacgtcagccgggcgggcgtcgaccgggtggtcggcagc
gccgcgcacctcgcccaggccgaccggatcgccgaggcgaccacgacgctgctgcgcaac
gagggcgggttcctgccgctgaacccggcacgccacggttcggtcctcgtcgtcggcgcc
gacccggcgtccccgtccggtacgacgggtccgccgacgaccaccctcgcgaccgccctg
acggagctcggcttcaccgcgaccgcgctgtccaccgggatcagcccgacggcggcgcgg
atcgaggaggcggtggcggcggccgccggcaaggacgtcgtcgtggtgggcacgtacaac
gtcacgggggcgagcccgcagcgcacgctcgtggcgcggctggtggcgaccggggtgccg
gtggtgacggtggcgatccgcaacccgtacgacatcgcctggctggagggtcagcgggcg
accctcgccacgtactcctggaccgatgtcgaactccgcgccgccgtacgggtcctggcg
ggccgggcccgcccgaggggccggctgccggtcccggtgcaggacgccgaggagccggcg
aaggtgctccacccggtcgggtacggactgtcgtaccgctga

DBGET integrated database retrieval system