KEGG   Streptomyces venezuelae: SVEN_2554Help
Entry
SVEN_2554         CDS       T02274                                 

Definition
Arginase or agmatinase or formimionoglutamate hydrolase, arginase family
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sve  Streptomyces venezuelae
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sve00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2778982..2779959)
Genome map
AA seq 325 aa AA seqDB search
MSSSDQNTPRGPIDSSRIPRYAGPATFARLPRLDEVGTADIAVVGVPFDSGVSYRPGARF
GGNAIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNINEAVETIEAAADDLLNSG
ARMMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEG
ILDTEALSHVGTRGPLYGKQDLTDDEKMGFGIVTSADIYRRGADEVADQLRQRIGDRPLY
ISIDIDCLDPAHAPGTGTPEAGGMTSRELLEILRGLSSCNLVSADVVEVAPAYDHAEITA
VAASHTAYELTTIMSRQIAESRAAQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagcgaccagaacaccccgcgcggcccgatcgactcgtcccgcatcccgcgg
tacgccggtcccgcgacgttcgcccggctgccgcgactcgacgaggtcggcaccgccgac
atcgccgtggtcggcgtccccttcgacagcggcgtctcctaccggcccggcgcccgcttc
ggcggcaacgccatccgcgaggcctcccgcctgctccgcccgtacaacccggcgcaggac
gcctccccgttcgccctcgcccaggtcgcggacgccggcgacatcgccgccaaccccttc
aacatcaacgaggccgtcgagaccatcgaggccgccgccgacgacctgctgaactccggc
gcccgcatgatgaccctcggcggcgaccacaccatcgcgctgccgctgctccgctccgtc
gccaagaagcacggccccgtcgccctgctccacttcgacgcacacctcgacacctgggac
acctacttcggcgccgagtacacccacggcaccccgttccgccgcgccgtcgaggagggc
atcctcgacaccgaggccctctcccacgtcggaacccgcggcccgctgtacggcaagcag
gacctcaccgacgacgagaagatgggcttcggcatcgtcacctcggccgacatctaccgc
cgcggcgccgacgaggtcgccgaccagctgcgccagcgcatcggcgaccgcccgctgtac
atctccatcgacatcgactgcctcgacccggcccacgcgcccggcaccggcaccccggag
gcgggcggcatgacctcccgcgagctcctggagatcctccgcggcctctcctcctgcaac
ctggtgtcggcggacgtcgtcgaggtcgccccggcgtacgaccacgccgagatcacggcc
gtcgccgcctcccacacggcgtacgaactgacgacgatcatgtcccgccagatcgccgag
agccgcgccgcgcagtag

DBGET integrated database retrieval system