KEGG   Streptomyces venezuelae: SVEN_2720Help
Entry
SVEN_2720         CDS       T02274                                 

Definition
putative transcriptional regulator
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sve  Streptomyces venezuelae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVEN_2720
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SVEN_2720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2963308..2964534)
Genome map
AA seq 408 aa AA seqDB search
MPGADRNDQEIRANRDRHASPSGSDLMDEQQEHGPAGPLAGFTVGVTAARRADELIALLR
RRGAAVVHGPALRIVPLADDTELLAATKELIAHAPDVVVATTAIGFRGWVEAAEGWGYGE
DLLAVLRDVELLARGPKVKGAVRAAGLTESWSPGSESMAEVLDRLLAEGVDGRRIALQLH
GEPLPGFVEALTAGGAEVVGVPVYRWMPPEDTGPLDRLLDAILSGGLDAVTFTSAPAAAS
LFARAAEKGVRDRLVAALRHDVLSVCVGPVTALPLQAEGIDTRAPERFRLGPLVQLLCTE
LPARSRVLPVAGHRVEVRGHAVLVDGVLRPVPPAGMALLGLLARRPGWVVSRADLLRALP
GAGRDEHAVETAMARLRSALGTPKLIQTVVKRGYRLSLDATPDTTYDG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcgcggaccgtaacgatcaggaaatacgggcgaaccgagaccgtcacgcgtca
ccgtcaggctctgacctcatggacgagcagcaagaacacggccccgccggccccctcgcc
ggcttcacggtcggcgtcaccgcggcgcggcgcgcggacgaactcatcgcgctgctgcgc
cggcgcggcgcggccgtcgtccacggccccgccctgcggatcgtgcccctcgcggacgac
accgaactcctcgccgccaccaaggaactcatcgcccacgccccggacgtcgtcgtcgcc
accacggcgatcggcttccggggctgggtcgaggcggcggagggctgggggtacggggag
gacctgctcgccgtcctgcgggacgtcgaactcctcgcccggggacccaaggtcaagggc
gccgtacgggccgccggactcaccgagtcctggtcacccggctccgagtccatggccgag
gtcctcgaccggctcctcgccgaaggcgtcgacgggcgccggatcgcgctccagctgcac
ggcgagccgctgcccggcttcgtcgaggcgctcaccgccggtggcgccgaggtcgtcggc
gtccccgtctaccgctggatgccgcccgaggacaccggccccctcgaccggctcctcgac
gcgatcctctccggcgggctcgacgccgtcaccttcaccagcgcccccgccgccgcctcg
ctgttcgcccgggccgcggagaagggcgtacgggaccggctcgtcgccgcactccggcac
gacgtgctctcggtgtgcgtcgggcccgtgacggcgctgccgctccaggccgagggcatc
gacacccgcgcccccgaacggttccggctcgggccgctcgtccagctcctgtgcacggag
ctgcccgcacggtcccgggtcctgcccgtggccgggcaccgggtcgaggtccgcggccac
gccgtactcgtcgacggcgtcctgcggcccgtcccgcccgccggaatggccctcctcggc
ctcctcgcccgccgccccggctgggtggtctcccgcgcggacctgctgcgcgcgctgccg
ggagccggacgggacgagcacgcggtggagacggcgatggcccggctccgctcggcgctc
ggcacgccgaagctgatccagacggtggtgaagcgcggctaccgcctgtccctcgacgcg
acgccggacaccacctacgacgggtga

DBGET integrated database retrieval system