KEGG   Streptomyces venezuelae: SVEN_2779Help
Entry
SVEN_2779         CDS       T02274                                 

Definition
L-glutamate ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
sve  Streptomyces venezuelae
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    SVEN_2779
Enzymes [BR:sve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     SVEN_2779
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     SVEN_2779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3047322..3048644
Genome map
AA seq 440 aa AA seqDB search
MNPADGIASAPSYRVWALPGLPEVTAGDDLAKLIASVSPELVDGDVLLVTSKIVSKAEGR
VIAADDREEAIDAETVRVVARRGTLRIVENRQGLVMAAAGVDASNTPPGTVLLLPEDPDA
SARRIRSGLREALGVDVGVVVTDTFGRPWRSGLTDVAIGAAGVRVLDDLRGGTDAHGNPL
SATVVATADELAAAGDLVKGKASGLPVAVVRGLPHVVAGDAEPGARALVRGAADDMFRLG
TSEAVREAVTLRRTVREFTGEAVDPGAVRRAVAAAVTAPAPHHTTPWRFVLLESERSRTR
LLDAMRDAWITDLRRDGKSEESIAKRVRRGDVLRNAPYLAVPCLVMDGSHHYGDPRRDAA
EREMFVVAAGAGVQNFLVALAGERLGSAWVSSTMFCREVVREVLDLPQDWDPLGAVAIGH
PAAPPRERAARGAAEFVEVR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccggcggacgggattgcctccgctccctcctaccgggtctgggccctgcccgga
ctgcccgaggtgacggccggggacgacctggccaagctgatcgcctccgtctcgccggag
ctcgtcgacggcgacgtcctgctcgtcacctccaagatcgtgagcaaggccgagggccgg
gtgatcgccgccgacgaccgcgaggaggccatcgacgccgagacggtacgggtggtggcg
cggcgcggcaccctgcggatcgtcgagaaccggcaggggctcgtcatggccgccgccggg
gtcgacgcctccaacaccccccccgggaccgtgctgttgctgcccgaggaccccgacgcc
tcggcacggcgcatccgttcgggactgcgcgaggcgctcggcgtggacgtcggcgtcgtc
gtcacggacaccttcgggcggccctggcgcagcggactcaccgacgtggcgatcggggcg
gccggggtgcgggtcctcgacgacctgcgcggcgggaccgacgcgcacggcaacccgctg
agcgcgacggtggtcgccaccgcagacgaactcgccgccgctggcgacctggtgaagggc
aaggcctccggccttccggtcgccgtcgtccgcggtctgccgcacgtcgtggccggggac
gcggaaccgggggcgcgggcgctggtgcgcggcgccgccgacgacatgttccggctcggg
acgtcggaggccgtacgggaggcggtgacgctgcggcggaccgtacgggagttcaccggc
gaagcggtcgacccgggtgcggtacggcgtgcggtcgccgcggccgtgacggcgcccgcc
ccgcaccacacgacgccgtggcggttcgtgctgctggagtccgagcggtcccggacgcgg
ctgctcgacgcgatgcgggacgcgtggatcaccgacctgcgccgcgacggcaagtccgag
gagtccatcgcgaagcgggtccggcgcggggacgtcctgcgcaacgcgccgtacctcgcc
gtgccctgcctcgtcatggacggctcccaccactacggcgacccgcgccgcgacgcggcc
gaacgcgagatgttcgtggtggcggccggcgcgggcgtccagaacttcctggtggcactg
gcgggcgagcggctgggctcggcgtgggtgtcctcgacgatgttctgccgcgaggtcgtc
cgcgaggtcctcgacctgccccaggactgggacccgctgggcgcggtcgcgatcggacac
ccggcggcgccgccgagggagcgggcggcgcggggggctgcggagttcgtcgaggtgcgc
tga

DBGET integrated database retrieval system