KEGG   Streptomyces venezuelae: SVEN_2952Help
Entry
SVEN_2952         CDS       T02274                                 

Definition
Fatty acid desaturase ; Delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sve  Streptomyces venezuelae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SVEN_2952
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SVEN_2952
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SVEN_2952
Lipid biosynthesis proteins [BR:sve01004]
 Desaturase
  First
   SVEN_2952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3227089..3228057
Genome map
AA seq 322 aa AA seqDB search
MTTSTELPATRQDLPSATLGGEKKRSIEQITLLLFITVPFIALIAAVPLAWSWGGVSWLD
LGLLVAMYYIGCHGITIGFHRYFTHGSFKAKRPLRIALAIMGSLAVEGPLVRWVADHRKH
HKFSDAEGDPHSPWRFGETVPALMKGLWWAHIGWMFDEERTPQAKYAPDLIKDPAIRRIS
RDFIFWTMLSLAIPPLVGGLVTMSWWGAFTAFFWGSLVRVALLHHVTWSINSICHAVGKR
PFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVLRGQVDSSARLIRWFEQAGWAY
DVRWPAKERIEARRQSAPADAA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgagtaccgagttgcccgcgacccgacaggatctgccgtccgccacgctcggc
ggggaaaagaagcggtcgatcgagcagatcacgctgttgctgttcatcacggtgccgttc
atcgcgctgatcgcggcggtgccgctggcctggagctggggcggcgtgtcgtggctcgat
ctggggctgctggtggccatgtactacatcggctgccacggcatcacgatcggtttccac
cgttacttcacgcacggttcgttcaaggccaagcggccgctgcggatcgccttggcgatc
atgggctcgctcgcggtggagggtccgctggtgcgctgggtggcggaccaccgcaagcac
cacaagttctccgacgcggagggcgacccgcactcgccgtggcggttcggcgagacggtg
ccggccctgatgaaggggctgtggtgggcgcacatcggctggatgttcgacgaggagcgg
acgccgcaggcgaagtacgcgcccgatctgatcaaggacccggcgatccggcggatctcg
cgtgacttcatcttctggacgatgctgtcgctcgcgatcccgccgctggtgggcggtctg
gtgacgatgtcgtggtggggcgcgttcaccgcgttcttctggggttcgctggtccgggtc
gcgctgctgcaccacgtgacctggtcgatcaactcgatctgtcacgcggtcggcaagcgc
ccgttcaagtcgcgggaccgctcgggcaacgtgtggtggctggccgtgctgtcctgcggg
gagtcctggcacaacctgcaccacgcggacccgacgtcggcccggcacggggtgctgcgc
ggccaggtcgactccagtgcgcggctgatccgctggttcgagcaggcgggctgggcgtac
gacgtgcgctggcctgcgaaggagcgcatcgaagcccgccgccagagcgcgcccgcagac
gcggcatga

DBGET integrated database retrieval system