KEGG   Streptomyces venezuelae: SVEN_3027Help
Entry
SVEN_3027         CDS       T02274                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sve  Streptomyces venezuelae
Pathway
sve00040  Pentose and glucuronate interconversions
sve00052  Galactose metabolism
sve00500  Starch and sucrose metabolism
sve00520  Amino sugar and nucleotide sugar metabolism
sve01100  Metabolic pathways
sve01130  Biosynthesis of antibiotics
Module
sve_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SVEN_3027
   00052 Galactose metabolism
    SVEN_3027
   00500 Starch and sucrose metabolism
    SVEN_3027
   00520 Amino sugar and nucleotide sugar metabolism
    SVEN_3027
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SVEN_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: CCA56313
UniProt: F2R7M8
Position
complement(3310648..3311559)
Genome map
AA seq 303 aa AA seqDB search
MNQSFPRLGRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAGLSDV
LMITGRNKRPLEDHFDRNYELEEALSRKGDDERLSKVQESSDLATMHYVRQGAPRGLGHA
VLCAAPHVGDQPFAVLLGDDLIDPRDPLLSRMVEVQEREGGSVIALMEVEPSQIHLYGCA
AVEATVDSDVVKVTDLVEKPDAGEAPSNYAIIGRYVLDPAVFGMLRETEPGRGGEIQLTD
ALQKLASDEKIGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRAWLRRYVS
EEM
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtcgttccccaggctcggccggatcagcaaggctgtcatcccggccgccggt
ctcggcacccgcttcctcccggcgacgaaggcgacgccgaaggagatgctgccggtcgtc
gacaagccggccatccagtacgtcgtcgaggaggccgtcgcggccggtctctccgacgtg
ctgatgatcaccggccggaacaagcgtcctctggaggaccacttcgaccggaactacgag
ctggaggaggcgctgagccggaagggcgacgacgaacgcctctccaaggtccaggagtcc
agtgacctcgccaccatgcactacgtgcgccagggcgccccgcgcggcctcggccacgcc
gtgctctgcgccgccccgcacgtcggcgaccagcccttcgcggtcctcctcggcgacgac
ctgatcgacccgcgcgacccgctgctctcgcggatggtggaggtccaggagcgggagggc
ggcagtgtgatcgccctcatggaggtcgagccctcccagatccacctgtacggctgcgcg
gcggtcgaggcgaccgtcgactcggacgtcgtgaaggtgacggacctggtcgagaagccg
gacgcgggcgaggcgcccagcaactacgcgatcatcggccgctacgtgctggacccggcc
gtcttcggcatgctccgggagaccgagccgggccgcggcggggagatccagctgaccgac
gccctgcagaagctcgcctccgacgagaagatcggcgggccggtgcacggggtcgtgttc
aagggccgccgctatgacaccggtgaccgcggggactatctgcgtgccattgtcagactc
gcgtgcgaacgtgaagatctgggaccggacttccgggcctggctccggagatacgtcagc
gaggagatgtag

DBGET integrated database retrieval system