KEGG   Streptomyces venezuelae: SVEN_3118Help
Entry
SVEN_3118         CDS       T02274                                 

Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sve  Streptomyces venezuelae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sve00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3418328..3420133
Genome map
AA seq 601 aa AA seqDB search
MPIGGFSTPRPGLPHPVGAHALTRSSAWRLGAFPVRVAQYEDRRVLVIGLCGASDDEVRG
LADHLVPADAAWRWPGAYAVVEEAPGGVVVHTDPASALPLYAVAWGGTWAWSTSARFLAA
LAGTRIDPERLACAVLAPSLPVLAEGRSFFAGVVRLPAGCRVVLPDDGGPRTHSVQWRPD
AVGGAPHVRLRDALGSGVRLRAAIDPGLSSDLSGGLDSTTIAGIAAAVVDSPLHAVTVHP
AGILDGADVSYARLAANASQGRIAHRLLPLTAEHRPYTRLREVPVTDEPAPSALTHARFL
GQLRWMHRTLGTRTHLTGDGGDSVLFQPPAHLADLIRHGRHRRAAGEAVGWARLRRTPVA
PLLRDAATMARTPRARSLERLAARLAAGPGARENAGNVRWFPTLPMPSWATPDALGLLGR
AAERAAAGPDELPGLDASVRVLVDDIREVARTAVADAELAAGCGIDLHNPFLDARVMDAV
LRTPLGGRAPLHAYKPTLVRAFADVLPAEVRARTTKGSFEADHFTGMRAALPELLDQAGL
HLASLDLIDLSLFRAGLRRAAAGVPMPLATIEQALAVDAWLHAISLAPTPRWASPVPGKA
I
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcggaggattcagcacgcccaggccaggccttccccacccggtcggcgcgcac
gctctcaccaggtcgtccgcttggcgattgggcgcgtttcccgtccgagtcgcccagtac
gaggaccgccgggtcctcgtcatcgggctctgcggggcgagcgacgacgaggtccggggc
ctggccgaccacctggtgcccgcggacgccgcatggcgttggcccggcgcgtacgcggtg
gtggaggaagcaccgggcggggtggtggtgcacaccgatccggcgagcgcgctgcccctg
tacgcggtcgcgtggggcgggacgtgggcatggtccacgtccgcccggttcctcgccgcc
ctggccggcacccggatcgatccggagcgcctggcctgtgccgtcctcgcgccttccctc
ccggtactggccgagggccggagcttcttcgccggtgtggtccgtctgccggcgggatgc
cgcgtcgtcctcccggacgacggtggcccccgcacgcactccgtccagtggcgcccggac
gcggtcggtggcgcaccgcacgtgcgactgcgcgacgccctcggctccggcgtacggctg
cgtgccgccatcgaccccgggctgtccagcgacctctccggagggctcgactccaccact
attgcgggcatcgccgcggctgtggtcgactcccctctccacgcggtcacggtccatccg
gcagggatcctcgacggagccgacgtctcgtacgcccgcctcgccgccaacgcatcgcag
ggtcggatcgcgcaccgactgctccccctgaccgccgagcaccggccgtacacccgtctg
cgggaagtacccgtgaccgacgaacccgccccgtccgccctcacgcacgctcgcttcctg
ggccagctccggtggatgcaccggacgctcgggacccgtacccacctgaccggtgacggt
ggcgacagcgtcctgttccagccgcccgcccacctggccgacctgatccggcacggtcgc
catcgacgggcggcgggcgaggccgtcgggtgggcgcggctccgccgtaccccggtcgcc
cccctccttcgtgatgccgcgaccatggcccgcaccccccgtgctcggtcgctggagcgc
ctcgcggccaggctggcggcgggacccggcgcgcgagagaacgcgggcaacgtccgctgg
ttccccacgctccccatgccgtcctgggcgactccggacgccctggggctcctgggtcgg
gccgccgagcgggcggcggccgggcccgacgagctgccgggtctcgacgcgtccgtgcgc
gtcctggtggacgacatcagggaagtggcccgcaccgccgtcgcggacgccgagctggcg
gcgggatgcggaatcgatctccacaacccgttcctggacgcacgggtgatggacgcggtg
ctacggaccccgctcggcggccgtgctccgctccacgcctacaagcccactctggtcagg
gcgttcgcggacgtactgcctgccgaggtccgcgcccgtacgacgaagggaagcttcgag
gccgaccacttcaccggcatgcgggccgccctgcccgaactgctggaccaggccggcctg
cacctggcgtccctggatctcatcgacctctccctcttccgggccggcttacgccgggca
gccgccggggtgccgatgccgctcgccacgatcgaacaggccctcgccgtggacgcctgg
ctgcacgcgatcagcctggcgcccacgccgaggtgggcctcccccgtgcccggaaaggcg
atctga

DBGET integrated database retrieval system