KEGG   Streptomyces venezuelae: SVEN_3179Help
Entry
SVEN_3179         CDS       T02274                                 

Definition
Uroporphyrinogen-III methyltransferase or Uroporphyrinogen-III synthase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sve  Streptomyces venezuelae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVEN_3179
Enzymes [BR:sve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     SVEN_3179
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SVEN_3179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3474588..3476258)
Genome map
AA seq 556 aa AA seqDB search
MNPTSPTTSPLSPAFAGHGHVTFLGAGPGDPGLLTLRAVEALAGADVLIAEPEVLEVVRC
HARAGVSTPELTVVDEASTTAGVPVLRDAANLVMEAARGGRRVVRAVTGDPGLDGNAGAE
MLACAAEGIPFEVVPGVATAVGVPAYAGVPLRDAQGTDVRFVDARTADERCWTEVGASDG
TVVVSTSLDSVAAAAGELVAAGRKPDTPLTVTIAGTTTRQRTWNATLGTIAQVFKQGKVL
PSPEGHRPVIAVVGERSAPAQRDQLSWFESKPLFGWRVLVPRTKEQAASLSDQLRSYGAV
PHEVPTIAVEPPRTPQQMERAVKGLVTGRYEWIAFTSVNAVKAVREKFEEYGLDARAFAG
IKVAAVGEQTAAALVDFGVKPDLVPSGEQSAAGLLEDWPPYDPVFDPIDRVFLPRADIAT
ETLVAGLIELGWEVDDVTAYRTVRASPPPADTREAIKGGGFDAVLFTSSSTVRNLVGIAG
KPHNVTVIACIGPATAKTAEEHGLRVDVLSPEPSVHKLAEALADFGLRRRAAALEAGDPV
TRPSERRPGARRRRTT
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccccaccagcccgaccaccagcccgctgtccccggccttcgcgggtcatggacac
gtcacattcctcggcgcaggccccggtgaccccggactcctgaccctcagggccgtcgag
gccctcgccggagcggatgtcctgatcgccgagccggaggtgctcgaggtcgttcgctgc
cacgcgcgcgcgggggtgagcacgccggagctgacggtcgttgacgaggcgtcaacaacc
gccggtgtccccgtgttgagggacgcggccaatcttgtcatggaggccgcgaggggcggc
aggcgggtcgtccgtgcggtgaccggcgaccccggcctcgacgggaacgcgggggccgag
atgctcgcctgcgccgccgagggcatccccttcgaggtcgtcccgggcgtggccacggcc
gtcggcgtacccgcgtacgccggtgtcccgctccgcgacgcccagggcaccgacgtgcgc
ttcgtcgacgcccgcaccgccgacgagcggtgctggaccgaggtcggtgcctccgacggc
accgtcgtcgtgtcgacgtcgctcgactcggtggccgcggccgccggtgaactggtggcg
gcaggccgtaagccggacaccccgctcaccgtcaccatcgccggtacgacgacgcgccag
cggacctggaacgcgacgctcggcaccatcgcccaggtcttcaagcagggcaaggtgctc
ccctcgcccgagggccaccggccggtgatagccgtggtcggcgagcgcagcgccccggcg
cagcgggaccagctgtcgtggttcgagtccaagccgctgttcggctggcgggtgctcgtg
ccgcggaccaaggagcaggccgcgtcgctctccgaccagcttcgttcgtacggcgcggtg
ccgcacgaggtgccgaccatcgccgtcgagccgccgcgcaccccgcagcagatggagcgg
gcggtcaaggggctcgtcaccggacggtacgagtggatcgccttcacctcggtcaacgcg
gtcaaggccgtgcgggagaagttcgaggagtacgggctcgacgcgcgtgccttcgccggg
atcaaggtcgcggcggtgggcgagcagacggccgccgcgctcgtcgacttcggtgtgaag
ccggacctcgtgccgagcggtgagcagtcggccgccggtctcctcgaggactggccgccg
tacgacccggtcttcgacccgatcgaccgcgtcttcctgccgcgggccgacatcgcgacc
gagacgctggtcgcggggctgatcgagctcgggtgggaggtcgacgacgtcaccgcctac
cggaccgtacgggcttcgccgccgccggcggacacccgggaggcgatcaagggcggcggc
ttcgacgccgtgctcttcacctcgtcgtcgaccgtgcggaacctggtcggcatcgccggg
aagccgcacaacgtgaccgtgatcgcgtgcatcgggcccgccacggccaagaccgccgag
gagcacgggctgcgggtggacgtgctgtcgcccgagccgtcggtgcacaagctcgcggag
gcgctggcggacttcggtctgcggcggcgggcggccgcgctggaggcgggcgatcccgtg
acgcggccttccgagcggcggccgggggcgcggaggcgtcgcacgacgtag

DBGET integrated database retrieval system