KEGG   Streptomyces venezuelae: SVEN_3253Help
Entry
SVEN_3253         CDS       T02274                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sve  Streptomyces venezuelae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SVEN_3253
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SVEN_3253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3563583..3564182
Genome map
AA seq 199 aa AA seqDB search
MKPTQSDPTVQPVPASVVATVDAADTTLSNPRWAVVALGANLGNRLETLQGAVDALADTP
GLRVKAVSPVYETEPWGVEPGTQPSYLNAVALLKTTLPPSSLLERAHAVEEAFHRVREEH
WGARTIDVDIVAYADVVSDDPVLTLPHPRAHQRAFVLAPWHDVDPEAQLPGHGPVTELLA
AVGGEGIARRADLELRLPE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgacgcagagcgaccccaccgtccagcccgtaccggcctccgtcgtcgcgacc
gtcgacgccgccgacacgacgctgtccaacccccgctgggccgtcgtggccctcggcgcc
aacctcggcaaccgcctggagaccctccagggggccgtcgacgccctcgccgacaccccc
ggcctccgcgtcaaggccgtctccccggtgtacgagacggagccctggggcgtcgagccc
ggcacccagccctcgtacctcaacgccgtcgcgctcctcaagacgaccctgccgccctcc
tccctcctggagcgggcccacgccgtcgaggaggccttccaccgcgtccgcgaggagcac
tggggcgcccgcaccatcgacgtcgacatcgtcgcctacgcggacgtggtctccgacgac
cccgtcctcaccctcccgcacccccgcgcccaccagcgcgccttcgtgctcgccccctgg
cacgacgtggaccccgaggcccagctccccggccacggaccggtcaccgagctcctcgcc
gccgtcggcggcgaaggcatcgcccgccgcgccgacctggaactccgtctgcccgagtag

DBGET integrated database retrieval system