KEGG   Streptomyces venezuelae: SVEN_3255Help
Entry
SVEN_3255         CDS       T02274                                 

Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sve  Streptomyces venezuelae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SVEN_3255
Enzymes [BR:sve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SVEN_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3564754..3565359)
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGEGTIGEFDEKRAEAAVRELLIAVGEDPDREGLRETPARVARAYKEIFAGLW
QVPEGVLTTTFDLGHDEMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPSTSGKITGLSKLA
RLVDVYARRPQVQERLTTQVADSLMDILEPRGVIVVFECEHMCMSMRGIRKPGAKTITSA
VRGQLRDPATRAEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggtgacgctggacggcgagggcacgatcggcgagttcgacgagaagcgc
gccgaggccgccgtgcgggagctcctcatcgcggtcggcgaggacccggaccgtgagggc
ctgagggagacgccggcgcgggtggcgcgggcgtacaaggagatattcgcgggcctgtgg
caggtgcccgagggcgtgctgacgacgacgttcgatctcggtcacgacgagatggtgcta
gtcaaggacattgaggtgtactcgacatgtgagcaccatctcgtaccgttccggggcgtc
gcccacgtcggttacatcccgtcgacgtccggcaagatcaccggcctgtcgaagctggcc
cggctcgtcgacgtctacgcccgccgtccccaggtgcaggaacggttgaccacccaggtg
gcggactccctgatggacatcctggagccgcggggcgtcatcgtggtcttcgagtgcgag
cacatgtgcatgtccatgcgcggcatccgcaagccgggcgccaagacgatcacctcggcc
gtccgcggccagctgcgcgaccccgcgacccgcgccgaggcgatgagcctcatcatggcg
cgctga

DBGET integrated database retrieval system