KEGG   Streptomyces venezuelae: SVEN_3374Help
Entry
SVEN_3374         CDS       T02274                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sve  Streptomyces venezuelae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sve00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SVEN_3374
DNA repair and recombination proteins [BR:sve03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SVEN_3374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3693011..3693625)
Genome map
AA seq 204 aa AA seqDB search
MEGRSVYEGVVQDLIDELGRLPGVGPKSAQRIAFHILQAEPTDVRRLAHALLEVKEKVRF
CAVCGNVAQQEQCNICRDPRRDLTVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIEG
VGPDDLRIRELLARLADGTVTELILATDPNLEGEATATYLARMIKPMGLKVTRLASGLPV
GGDLEYADEVTLGRAFEGRRLLDV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttggaagggcgttccgtgtacgaaggcgtggttcaggacctcatcgacgaactgggcagg
ctgcccggcgtcggtcccaagagcgcgcagcggatcgccttccacatcctccaggccgag
cccacggacgtccgccgtctcgcgcacgccctcctggaggtcaaggagaaggtcaggttc
tgcgcggtctgcggcaacgtcgcccagcaggagcagtgcaacatctgccgcgacccgcgc
cgcgacctgaccgtcatctgtgtggtcgaggaacccaaggacgtcgtcgcgatcgagcgg
acccgcgagttccgggggcggtaccacgtcctcggcggcgcgatcagccccatcgaaggc
gtcggcccggacgacctgcgcatccgcgaactgctcgcgcggctcgccgacggcacggtc
accgaactgatcctcgcgaccgatccgaacctggagggcgaggccaccgcgacgtacctg
gcgcggatgatcaagcccatgggactgaaggtgacccggctcgccagcgggctcccggtc
ggcggcgacctcgagtacgccgacgaagtgaccctgggccgtgccttcgagggacggagg
ctgctagatgtatga

DBGET integrated database retrieval system