KEGG   Streptomyces venezuelae: SVEN_3585Help
Entry
SVEN_3585         CDS       T02274                                 

Definition
Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sve  Streptomyces venezuelae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_3585
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_3585
   00020 Citrate cycle (TCA cycle)
    SVEN_3585
   00620 Pyruvate metabolism
    SVEN_3585
Enzymes [BR:sve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SVEN_3585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3896001..3897446)
Genome map
AA seq 481 aa AA seqDB search
MTIREFKMPDVGEGLTEAEILKWYVQPGDTVTDGQVVCEVETAKAAVELPIPFDGTVHEL
LFPEGTTVDVGQVIISVNVGGGTAPEAPVAEAAPAPVESVVAVAVAEEEAEPQGRTPVLV
GYGVAASSTKRRPRKGAQGAVQAAPAQAAPAPAAPVVSVPGQLNGHAPAAARPLAKPPVR
KLAKDLGVDLATVTPTGPDGIITRDDVHAAAAPAPAPVVEAPAPVAAAPATAASAPAAAA
PAPLVSTDARETRIPVKGVRKATAAAMVGSAFTAPHVTEFVTFDITRTMKLVEELKSGTD
MAGLRVNPLLIIAKAVLVAVRRNPEINAAWDEAAQEIVLKHYVNLGIAAATPRGLLVPNI
KDAHAQTLPELSASLSELVSTAREGKTTPAAMQGGTFTITNVGVFGVDTGTPILNPGESA
ILAVGAIKLQPWVHKGKVKPRQVTTLALSFDHRLVDGELGSKFLADVAAILEQPKRLITW
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatccgcgaattcaagatgcccgacgtgggcgagggcctgaccgaggccgagatc
ctcaagtggtacgtccagcccggtgacaccgtcaccgacgggcaggtcgtgtgcgaggtc
gagacggccaaggccgccgtcgagctgccgatccccttcgacggcacggtccacgagctc
ctcttccccgagggcaccacggtcgacgtcggccaggtcatcatctcggtgaacgtcggc
gggggcaccgcgcccgaggcgccggtggccgaggccgctccggccccggtcgagtccgtc
gtggccgtggccgtcgccgaggaggaggccgagccgcagggccgtacgcctgtcctcgtc
ggttacggcgtggccgcaagctccaccaagcgacgcccccgcaagggtgcgcagggcgcg
gtccaggccgcccccgcccaggccgctcccgccccggcggcgcccgtcgtctccgtaccg
gggcagctcaacggccacgcgccggctgccgcacggcccctggccaagcctccggtccgg
aagctcgccaaggacctcggcgtcgacctcgccacggtcaccccgaccggcccggacggc
atcatcacccgggacgacgtccacgccgcggccgctccggcgcccgcaccggtcgtcgag
gccccggctccggtggcggcggcccctgcgactgccgcctccgccccggcggcggctgcc
cccgccccgctggtgtcgaccgatgcccgggagacccgtatccccgtcaagggcgtacgg
aaggccacggcggcggcgatggtcggttcggccttcaccgccccgcacgtcaccgagttc
gtgaccttcgacatcacgcgcacgatgaagctggtcgaggagctcaagtccggtacggac
atggcgggtctgcgggtcaacccgctgctcatcatcgccaaggccgtcctggtcgccgtc
cggcgcaacccggagatcaacgcggcctgggacgaggcggcgcaggagatcgtcctcaag
cactacgtgaacctgggcatcgccgcggccaccccgcgcggcctgctcgtgccgaacatc
aaggacgcgcacgcgcagaccctgcccgagctgtcggcctccctgagcgagctggtctcc
accgcccgcgaggggaagaccaccccggcggcgatgcagggcggcaccttcaccatcacc
aacgtcggcgtcttcggcgtcgacaccggtacgcccatcctgaaccccggcgagtccgcg
atcctcgcggtcggtgcgatcaagctccagccgtgggtccacaagggcaaggtgaagccg
cgccaggtcacgacgctggccctctccttcgaccaccgtctggtcgacggcgagctcggc
tccaagttcctggccgacgtcgccgcgatcctggagcagccgaagcgcctgatcacctgg
gcctga

DBGET integrated database retrieval system