KEGG   Streptomyces venezuelae: SVEN_3603Help
Entry
SVEN_3603         CDS       T02274                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sve  Streptomyces venezuelae
Pathway
sve00010  Glycolysis / Gluconeogenesis
sve00020  Citrate cycle (TCA cycle)
sve00620  Pyruvate metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
sve01200  Carbon metabolism
Module
sve_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_3603
   00020 Citrate cycle (TCA cycle)
    SVEN_3603
   00620 Pyruvate metabolism
    SVEN_3603
Enzymes [BR:sve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SVEN_3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CCA56889
UniProt: F2RCZ3
Position
complement(3916521..3918008)
Genome map
AA seq 495 aa AA seqDB search
MAQVLEFKLPDLGEGLTEAEIVRWLVSVGDVVAIDQPVVEVETAKAMVEVPCPYGGVVTA
RYGEEGTELPVGAPLLTVAVGGGAGVEPETSAPAAQSAPAAQDAPASPAAAAPQGDAASA
VSSEYSGNVLVGYGTAGPAARRRRVRHASPAVAQASTAVAAPPAPVAAPAPAPVSAPASA
PAVVAGGGHEGPVPVISPLVRKLARDRGLDLREVRGSGPEGLILRADVELALAALERPVA
APAPTVGSAPAAGSVAAPVAVSASSAAGERIPLRGVRGAVADKLSRSRTEIPDATCWVDA
DATELMAARAAMNGAGGPKISLLALLARICVHALARFPELNSTVDTAAREIVRLPGVHLG
FAAQTPRGLVVPVVKDAGTRTAESLTAEFARLTEAARQSALTPADLTGGTFTLNNYGVFG
VDGSTPIINHPEAAMLGVGRIIPKPWVHQGELAVRQVVQLSLTFDHRVCDGGTAGGFLRY
VADCVEQPAVLLRTL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggtgctcgagttcaagctgcccgacctcggtgaggggctcaccgaggcggag
atcgtccgctggctggtcagcgtcggcgacgtcgtcgccatcgaccagccggtcgtcgag
gtcgagacggccaaggccatggtcgaggtgccctgcccgtacggcggggtcgtcaccgcc
cggtacggcgaggagggcaccgaactgcccgtcggcgccccgctcctgacggtcgccgtg
ggcggcggcgcgggcgtggagcccgagacctccgccccggccgcccagagcgccccggcc
gcccaggacgctccggcgtccccggccgccgccgctcctcagggtgacgccgcgtcggcc
gtctcgtcggagtactcgggcaacgtgctcgtcgggtacggcacggcgggtccggccgcc
cggcgccgccgggtgcggcacgcgagcccggccgtggcgcaggcgtccaccgccgtcgcc
gcaccgcccgcgccggtggccgcgcccgctcccgcgccggtctcggctccggcctccgca
ccggccgtcgtggccgggggcgggcacgaggggccggtaccggtcatctcgccactcgtc
cgcaagctggcaagggaccgtgggctcgacctgcgcgaggtccgcggctcgggtcccgag
ggcctgatcctgcgggccgacgtcgagctggcgctcgccgccctggagcgcccggtcgcc
gcgccggcgccgacggtcggctccgcccccgcggcgggttctgtcgcggcgcccgtcgcc
gtgtccgcttcctcggccgccggtgagcggattccgctgcgcggggtccggggtgccgtg
gcggacaagctctcccgcagccgtaccgagatcccggacgcgacctgctgggtcgacgcc
gacgcgaccgaactcatggccgcgcgggccgcgatgaacggagccggcggcccgaagatc
tcgctgctcgcgctcctcgcccggatctgtgtccacgccctggcccggttccccgagctc
aactccaccgtggacaccgccgcccgggagatcgtccggctgccgggcgtgcacctgggc
ttcgccgcccagacgccgcgcggcctggtcgttcccgtggtgaaggacgcggggacgcgg
acggccgagtcgctcaccgcagagttcgcccggctgacggaggccgcccggcagtccgcg
ctcacccccgccgatctgaccggcggcacgttcaccctgaacaactacggggtgttcggg
gtcgacgggtccacgccgatcatcaaccaccccgaggccgcgatgctcggcgtcggccgg
atcatccccaagccctgggtgcaccagggcgaactggcggtgcgtcaagtggtgcagctg
tcgctcaccttcgaccaccgggtctgcgacggcggtacggcgggcgggttcctgcggtac
gtggcggactgcgtcgagcagccggcggtcctgctccgtacgctctga

DBGET integrated database retrieval system