KEGG   Streptomyces venezuelae: SVEN_3603Help
Entry
SVEN_3603         CDS       T02274                                 

Definition
Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sve  Streptomyces venezuelae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sve01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sve00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sve00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sve00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3916521..3918008)
Genome map
AA seq 495 aa AA seqDB search
MAQVLEFKLPDLGEGLTEAEIVRWLVSVGDVVAIDQPVVEVETAKAMVEVPCPYGGVVTA
RYGEEGTELPVGAPLLTVAVGGGAGVEPETSAPAAQSAPAAQDAPASPAAAAPQGDAASA
VSSEYSGNVLVGYGTAGPAARRRRVRHASPAVAQASTAVAAPPAPVAAPAPAPVSAPASA
PAVVAGGGHEGPVPVISPLVRKLARDRGLDLREVRGSGPEGLILRADVELALAALERPVA
APAPTVGSAPAAGSVAAPVAVSASSAAGERIPLRGVRGAVADKLSRSRTEIPDATCWVDA
DATELMAARAAMNGAGGPKISLLALLARICVHALARFPELNSTVDTAAREIVRLPGVHLG
FAAQTPRGLVVPVVKDAGTRTAESLTAEFARLTEAARQSALTPADLTGGTFTLNNYGVFG
VDGSTPIINHPEAAMLGVGRIIPKPWVHQGELAVRQVVQLSLTFDHRVCDGGTAGGFLRY
VADCVEQPAVLLRTL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggtgctcgagttcaagctgcccgacctcggtgaggggctcaccgaggcggag
atcgtccgctggctggtcagcgtcggcgacgtcgtcgccatcgaccagccggtcgtcgag
gtcgagacggccaaggccatggtcgaggtgccctgcccgtacggcggggtcgtcaccgcc
cggtacggcgaggagggcaccgaactgcccgtcggcgccccgctcctgacggtcgccgtg
ggcggcggcgcgggcgtggagcccgagacctccgccccggccgcccagagcgccccggcc
gcccaggacgctccggcgtccccggccgccgccgctcctcagggtgacgccgcgtcggcc
gtctcgtcggagtactcgggcaacgtgctcgtcgggtacggcacggcgggtccggccgcc
cggcgccgccgggtgcggcacgcgagcccggccgtggcgcaggcgtccaccgccgtcgcc
gcaccgcccgcgccggtggccgcgcccgctcccgcgccggtctcggctccggcctccgca
ccggccgtcgtggccgggggcgggcacgaggggccggtaccggtcatctcgccactcgtc
cgcaagctggcaagggaccgtgggctcgacctgcgcgaggtccgcggctcgggtcccgag
ggcctgatcctgcgggccgacgtcgagctggcgctcgccgccctggagcgcccggtcgcc
gcgccggcgccgacggtcggctccgcccccgcggcgggttctgtcgcggcgcccgtcgcc
gtgtccgcttcctcggccgccggtgagcggattccgctgcgcggggtccggggtgccgtg
gcggacaagctctcccgcagccgtaccgagatcccggacgcgacctgctgggtcgacgcc
gacgcgaccgaactcatggccgcgcgggccgcgatgaacggagccggcggcccgaagatc
tcgctgctcgcgctcctcgcccggatctgtgtccacgccctggcccggttccccgagctc
aactccaccgtggacaccgccgcccgggagatcgtccggctgccgggcgtgcacctgggc
ttcgccgcccagacgccgcgcggcctggtcgttcccgtggtgaaggacgcggggacgcgg
acggccgagtcgctcaccgcagagttcgcccggctgacggaggccgcccggcagtccgcg
ctcacccccgccgatctgaccggcggcacgttcaccctgaacaactacggggtgttcggg
gtcgacgggtccacgccgatcatcaaccaccccgaggccgcgatgctcggcgtcggccgg
atcatccccaagccctgggtgcaccagggcgaactggcggtgcgtcaagtggtgcagctg
tcgctcaccttcgaccaccgggtctgcgacggcggtacggcgggcgggttcctgcggtac
gtggcggactgcgtcgagcagccggcggtcctgctccgtacgctctga

DBGET integrated database retrieval system