KEGG   Streptomyces venezuelae: SVEN_4038Help
Entry
SVEN_4038         CDS       T02274                                 

Definition
Predicted N-acetyl-glucosamine kinase 2, ROK family (EC:2.7.1.59)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sve  Streptomyces venezuelae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_4038
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_4038
   00052 Galactose metabolism
    SVEN_4038
   00500 Starch and sucrose metabolism
    SVEN_4038
   00520 Amino sugar and nucleotide sugar metabolism
    SVEN_4038
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SVEN_4038
   00524 Butirosin and neomycin biosynthesis
    SVEN_4038
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SVEN_4038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4372565..4373485)
Genome map
AA seq 306 aa AA seqDB search
MKAALVGADGTLLHEARRATGRERGPEAVVETILSFAAELRALGQERYGEPAAAAGVAVP
GIVDAENGIAVYAANLGWRDVPMRELLSRRLDGIPVALGHDVRTGGLAEGRIGAGNGADR
FLFVPLGTGIAGAIGIGDRIEAGAHGYAGEIGHIVVRPGGTACGCGQRGCLERYASASAV
SQAWAEASGDPEADAADCAKAVESGDATAVRVWQDAVDALADGLVTALTLLDPRTLIIGG
GLAEAGETLFTPLRAAVEERVTFQKLPAIVPAALGDTAGCLGAGLLAWDLLADQHPQRPT
DSEVSA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccctcgtcggggcggacggcaccctgctccacgaggcccgccgcgccacc
gggcgcgagcgcggccccgaggccgtcgtggagacgatcctcagcttcgccgcggagctc
cgcgccctcggccaggagcggtacggcgagcccgccgcggccgccggagtcgccgtcccc
ggcatcgtcgacgcggagaacggcatcgccgtctacgccgccaacctcggctggcgcgac
gttcccatgcgcgaactcctcagccgccgactcgacggcatccccgtcgccctcggccac
gacgtccgcaccggcggcctcgccgaaggccggatcggcgcgggcaacggcgccgaccgc
ttcctcttcgtccccctcggtacgggcatcgccggcgccatcggcatcggcgaccgcatc
gaggccggcgcccacggctacgccggcgagatcggccacatcgtcgtccgccccggcggc
accgcctgcggctgcggccagcgcggctgcctggagcggtacgcctccgcctccgccgtc
tcccaggcctgggccgaggcgagcggcgaccccgaggccgacgccgccgactgcgccaag
gccgtcgaatccggcgacgccaccgccgtccgggtctggcaggacgccgtcgacgccctc
gccgacggcctggtcaccgccctcaccctgctggacccgcgcacgctcatcatcggtggc
ggactggccgaggccggggaaaccttgttcacaccacttcgggccgcggtggaggagcga
gtcacgttccagaagctgcccgccatcgtcccggcggccctcggggacaccgccggttgc
ctgggcgcgggcctcctcgcctgggacctgctcgccgaccagcacccccagcgccccacc
gactcggaggtttccgcctga

DBGET integrated database retrieval system