KEGG   Streptomyces venezuelae: SVEN_4046Help
Entry
SVEN_4046         CDS       T02274                                 

Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SVEN_4046
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVEN_4046
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SVEN_4046
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SVEN_4046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4382898..4384208
Genome map
AA seq 436 aa AA seqDB search
MRRKGLASMAVQNAASAATVDLGPASGLSCRECGEVFPLGPIFACELCFGPLEVAYELPT
GDPEALRKQIEAGPANIWRYAPLLPVPADVAEKPNLNPGWTKLVQADNLAREIGVAPGKL
FVKDDSGNPTHSFKDRVVAQAIEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFI
PHDLEQGKVVMAGVYGGELVAIEGNYDDVNRFCSELIGDPLGEGWGFVNVNLRPYYGEGS
KTLAYEICEQLGWVIPDQLVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGC
SPVSVAFKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVDDEQVVDAI
KLLARTEGIFAETAGGVTLGVTRKLVKDGLIDPNLTTVVLNTGDGLKTLDAVADTSQATA
TIRPSLDAFRDAGLAV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaagggcctcgcctccatggctgtacagaacgccgcttccgccgccaccgtc
gacctcggtcccgcgtccgggctttcctgccgcgaatgcggtgaagtcttcccgctcggt
ccgatcttcgcctgcgagctctgtttcggaccgctcgaagtcgcgtacgagctccccacc
ggtgaccccgaggcgctgcgcaagcagatcgaggccggacccgccaacatctggcgctac
gcccccctgctgcccgtcccggccgacgtcgccgagaagccgaacctgaacccgggctgg
accaagctcgtccaggccgacaacctcgcccgcgagatcggcgtcgcccccggcaagctc
ttcgtcaaggacgactccggcaacccgacccactccttcaaggaccgggtcgtcgcccag
gccatcgaggccgcccgcgccttcggcttcaccaccctctcctgctcctccaccggcaac
ctggccggcgccgtcggcgccgccgccgcccgcgccggcttccgctcctgcgtgttcatc
ccgcacgacctggagcagggcaaggtcgtcatggccggtgtctacggcggtgaactcgtc
gccatcgaaggcaactacgacgacgtcaaccgcttctgctccgagctcatcggcgacccg
ctcggcgagggctggggcttcgtcaacgtcaacctccgcccgtactacggcgaaggctcc
aagacgctggcgtacgagatctgcgagcagctcggctgggtcatccccgaccagctcgtc
atcccgatcgcctccggctcccagctcacgaagatcgacaagggtctccaggagctcatc
aagctgggcctcgtcgaggacaagccgtacaagatcttcggtgcgcaggccgagggctgc
tccccggtgtcggtggccttcaaggccgggcacgacgtcgtgcggccccagaagccgaac
acgatcgccaagtccctcgcgatcggcaacccggccgacggcccgtacgtcctcgacatc
gcccgccggaccggcggcgccgtggaggacgtcgacgacgagcaggtcgtggacgcgatc
aagctcctcgcgcggaccgagggcatcttcgccgagaccgcgggcggcgtgaccctcggc
gtgacgcggaagctcgtcaaggacgggctgatcgacccgaacctcaccaccgtcgtcctc
aacaccggcgacggactcaagaccctggacgcggtggccgacacctctcaggcgaccgcc
accatccgcccgagcctggacgccttccgcgacgccggcctggccgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system