KEGG   Streptomyces venezuelae: SVEN_4046Help
Entry
SVEN_4046         CDS       T02274                                 

Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SVEN_4046
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVEN_4046
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SVEN_4046
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SVEN_4046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4382898..4384208
Genome map
AA seq 436 aa AA seqDB search
MRRKGLASMAVQNAASAATVDLGPASGLSCRECGEVFPLGPIFACELCFGPLEVAYELPT
GDPEALRKQIEAGPANIWRYAPLLPVPADVAEKPNLNPGWTKLVQADNLAREIGVAPGKL
FVKDDSGNPTHSFKDRVVAQAIEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFI
PHDLEQGKVVMAGVYGGELVAIEGNYDDVNRFCSELIGDPLGEGWGFVNVNLRPYYGEGS
KTLAYEICEQLGWVIPDQLVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGC
SPVSVAFKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVDDEQVVDAI
KLLARTEGIFAETAGGVTLGVTRKLVKDGLIDPNLTTVVLNTGDGLKTLDAVADTSQATA
TIRPSLDAFRDAGLAV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaagggcctcgcctccatggctgtacagaacgccgcttccgccgccaccgtc
gacctcggtcccgcgtccgggctttcctgccgcgaatgcggtgaagtcttcccgctcggt
ccgatcttcgcctgcgagctctgtttcggaccgctcgaagtcgcgtacgagctccccacc
ggtgaccccgaggcgctgcgcaagcagatcgaggccggacccgccaacatctggcgctac
gcccccctgctgcccgtcccggccgacgtcgccgagaagccgaacctgaacccgggctgg
accaagctcgtccaggccgacaacctcgcccgcgagatcggcgtcgcccccggcaagctc
ttcgtcaaggacgactccggcaacccgacccactccttcaaggaccgggtcgtcgcccag
gccatcgaggccgcccgcgccttcggcttcaccaccctctcctgctcctccaccggcaac
ctggccggcgccgtcggcgccgccgccgcccgcgccggcttccgctcctgcgtgttcatc
ccgcacgacctggagcagggcaaggtcgtcatggccggtgtctacggcggtgaactcgtc
gccatcgaaggcaactacgacgacgtcaaccgcttctgctccgagctcatcggcgacccg
ctcggcgagggctggggcttcgtcaacgtcaacctccgcccgtactacggcgaaggctcc
aagacgctggcgtacgagatctgcgagcagctcggctgggtcatccccgaccagctcgtc
atcccgatcgcctccggctcccagctcacgaagatcgacaagggtctccaggagctcatc
aagctgggcctcgtcgaggacaagccgtacaagatcttcggtgcgcaggccgagggctgc
tccccggtgtcggtggccttcaaggccgggcacgacgtcgtgcggccccagaagccgaac
acgatcgccaagtccctcgcgatcggcaacccggccgacggcccgtacgtcctcgacatc
gcccgccggaccggcggcgccgtggaggacgtcgacgacgagcaggtcgtggacgcgatc
aagctcctcgcgcggaccgagggcatcttcgccgagaccgcgggcggcgtgaccctcggc
gtgacgcggaagctcgtcaaggacgggctgatcgacccgaacctcaccaccgtcgtcctc
aacaccggcgacggactcaagaccctggacgcggtggccgacacctctcaggcgaccgcc
accatccgcccgagcctggacgccttccgcgacgccggcctggccgtctga

DBGET integrated database retrieval system