KEGG   Streptomyces venezuelae: SVEN_4046Help
Entry
SVEN_4046         CDS       T02274                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
sve00260  Glycine, serine and threonine metabolism
sve00750  Vitamin B6 metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01230  Biosynthesis of amino acids
Module
sve_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVEN_4046
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SVEN_4046
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SVEN_4046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCA57332
UniProt: F2RH04
Position
4382898..4384208
Genome map
AA seq 436 aa AA seqDB search
MRRKGLASMAVQNAASAATVDLGPASGLSCRECGEVFPLGPIFACELCFGPLEVAYELPT
GDPEALRKQIEAGPANIWRYAPLLPVPADVAEKPNLNPGWTKLVQADNLAREIGVAPGKL
FVKDDSGNPTHSFKDRVVAQAIEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFI
PHDLEQGKVVMAGVYGGELVAIEGNYDDVNRFCSELIGDPLGEGWGFVNVNLRPYYGEGS
KTLAYEICEQLGWVIPDQLVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGC
SPVSVAFKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVDDEQVVDAI
KLLARTEGIFAETAGGVTLGVTRKLVKDGLIDPNLTTVVLNTGDGLKTLDAVADTSQATA
TIRPSLDAFRDAGLAV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaagggcctcgcctccatggctgtacagaacgccgcttccgccgccaccgtc
gacctcggtcccgcgtccgggctttcctgccgcgaatgcggtgaagtcttcccgctcggt
ccgatcttcgcctgcgagctctgtttcggaccgctcgaagtcgcgtacgagctccccacc
ggtgaccccgaggcgctgcgcaagcagatcgaggccggacccgccaacatctggcgctac
gcccccctgctgcccgtcccggccgacgtcgccgagaagccgaacctgaacccgggctgg
accaagctcgtccaggccgacaacctcgcccgcgagatcggcgtcgcccccggcaagctc
ttcgtcaaggacgactccggcaacccgacccactccttcaaggaccgggtcgtcgcccag
gccatcgaggccgcccgcgccttcggcttcaccaccctctcctgctcctccaccggcaac
ctggccggcgccgtcggcgccgccgccgcccgcgccggcttccgctcctgcgtgttcatc
ccgcacgacctggagcagggcaaggtcgtcatggccggtgtctacggcggtgaactcgtc
gccatcgaaggcaactacgacgacgtcaaccgcttctgctccgagctcatcggcgacccg
ctcggcgagggctggggcttcgtcaacgtcaacctccgcccgtactacggcgaaggctcc
aagacgctggcgtacgagatctgcgagcagctcggctgggtcatccccgaccagctcgtc
atcccgatcgcctccggctcccagctcacgaagatcgacaagggtctccaggagctcatc
aagctgggcctcgtcgaggacaagccgtacaagatcttcggtgcgcaggccgagggctgc
tccccggtgtcggtggccttcaaggccgggcacgacgtcgtgcggccccagaagccgaac
acgatcgccaagtccctcgcgatcggcaacccggccgacggcccgtacgtcctcgacatc
gcccgccggaccggcggcgccgtggaggacgtcgacgacgagcaggtcgtggacgcgatc
aagctcctcgcgcggaccgagggcatcttcgccgagaccgcgggcggcgtgaccctcggc
gtgacgcggaagctcgtcaaggacgggctgatcgacccgaacctcaccaccgtcgtcctc
aacaccggcgacggactcaagaccctggacgcggtggccgacacctctcaggcgaccgcc
accatccgcccgagcctggacgccttccgcgacgccggcctggccgtctga

DBGET integrated database retrieval system