KEGG   Streptomyces venezuelae: SVEN_4463Help
Entry
SVEN_4463         CDS       T02274                                 

Definition
putative cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sve  Streptomyces venezuelae
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SVEN_4463
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SVEN_4463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4809883..4811715
Genome map
AA seq 610 aa AA seqDB search
MTAVPPTQNQEPADDAYDYDVLVVGSGFGGSVTALRLTEKGYRVGVLEAGRRFTPETLPK
NSWDLKNFLWAPALGLYGLQRIHLLGNVMVLAGAGVGGGSLNYANTLYVPPKPFFDDPQW
KDITDWQEELRPYYDQAQRMLGVRLNPTTTPSDVHLKAAAQAMGIGDTFHMAPVGVFFGD
GLDADGGDGAGTKVKPGTEVADPYFGGAGPSRRACTECGECMTGCRHGAKNTLNENYLHL
AEKAGATVHPMTTVVTVTEDSRGGFAVKTLPTDQRRKGKGRTFTARRVVIAAGTYGTQTL
LHRMKDSGLLPRISRRLGELTRTNSEGLVGAQTTDRRYRKRHGKDRVDFTKGVAITSSVH
PDANTHIEPVRYGKGSNSMGGMTVLQVPYGAHRVRNWLLNLVKHPTLAARSLSNWRWSER
TIIGLVMQSLDNSLTTYRKPGGLGKGLLTARQGHGAPNPVQIPEATRAATLLAEEINGFA
GSNIGELMGTPLTAHFLGGCPIGADAESGVIDPYHRLYGHPGISVVDGAAVSANLGVNPS
LTITAQAERAMSFWPNKGEEDIRPRQGEAYVRLSAVEPKSPAVPAEAFGALRLPFLGIPA
VPPKTLRDGS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggtaccccctacccaaaatcaggagccggcggacgacgcgtacgactacgac
gtcctcgtcgtgggctccggcttcggcggttcggtcaccgccctccgcctcaccgagaag
ggctaccgggtcggtgtcctggaggccgggcggcgcttcacccccgagaccctgccgaag
aactcctgggacctgaagaacttcctgtgggcccccgccctcggcctgtacggcctccag
cgcatccatctgctcggcaacgtcatggtgctcgcgggcgccggagtcggcggcggctcc
ctcaactacgccaacaccctgtacgtaccgcccaagcccttcttcgacgacccgcagtgg
aaggacatcaccgactggcaggaggagctgcggccgtactacgaccaggcccagcggatg
ctcggcgtccggctcaacccgacgacgaccccctccgacgtgcacctcaaggccgccgcc
caggccatggggatcggcgacaccttccacatggcccccgtcggcgtcttcttcggggac
ggcctcgacgccgacggcggggacggagccggtacgaaggtgaagcccggcaccgaggtc
gccgacccgtacttcggcggcgcgggcccgtcccggcgcgcctgcaccgagtgcggcgag
tgcatgaccggctgccgtcacggcgccaagaacaccctcaacgagaactacctccacctc
gccgagaaggcgggcgccaccgtccaccccatgaccacggtcgtcaccgtcaccgaggac
tcgcggggcggcttcgcggtgaagaccctccccaccgaccagcggcgcaagggcaagggg
cgcaccttcaccgcccgccgggtggtgatcgcggccggcacgtacggcacccagaccctg
ctgcaccggatgaaggacagcggcctgctgccccggatctcgcggcggctcggcgagctc
acccggaccaactccgagggcctggtcggcgcgcagaccaccgaccgccgctaccgcaag
cggcacggcaaggaccgggtcgacttcaccaagggcgtcgcgatcacctcctcggtccac
cccgacgccaacacccacatcgaacccgtgcggtacggcaagggctccaactcgatgggc
ggcatgaccgtcctccaggtgccctacggggcccaccgggtgcgcaactggctgctcaac
ctcgtcaagcaccccacgctggccgcccgctccctctccaactggcgctggtcggagcgg
accatcatcggcctggtcatgcagtccctcgacaactccctgacgacctaccgcaagccc
ggcggcctcggaaagggcctgctcacggcccgccaggggcacggcgcgccgaacccggtc
cagatccccgaggccacccgcgccgccacgctcctcgccgaggagatcaacggcttcgcc
ggctccaacatcggcgagctgatgggcaccccgctgaccgcccacttcctgggcggctgc
ccgatcggcgccgacgccgagtccggcgtcatcgacccgtaccaccggctctacgggcac
ccggggatctccgtcgtcgacggcgcggccgtctccgcgaacctgggcgtgaacccgtcc
ctgacgatcaccgcgcaggcggagcgggcgatgtcgttctggcccaacaagggcgaggag
gacatcaggccccggcagggcgaggcgtacgtacggctgtcggcggtcgagcccaagtcc
ccggccgtcccggcggaggccttcggcgccctgcggctgccgttcctggggattccggcg
gttccgccgaagacgctccgagacggctcctga

DBGET integrated database retrieval system