KEGG   Streptomyces venezuelae: SVEN_4485Help
Entry
SVEN_4485         CDS       T02274                                 

Definition
(RefSeq) Succinyl-CoA ligase (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sve  Streptomyces venezuelae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_4485
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVEN_4485
   00640 Propanoate metabolism
    SVEN_4485
   00660 C5-Branched dibasic acid metabolism
    SVEN_4485
Enzymes [BR:sve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SVEN_4485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4838389..4839663
Genome map
AA seq 424 aa AA seqDB search
MYASLVTAQSRCPPRHAHADNEPRSSEKGRTRVDLFEYQARDLFAKHGVPVLAGEVIDTP
EAARAATERLGGKSVVKAQVKVGGRGKAGGVKLAADADEAVARATDILGMDIKGHTVHKV
MIAELSPEIEAEYYVSYLLDRTNRTFLAMASVQGGMDIEEVAEKTPEALAKVPVNANDGV
TLEKAREIVAQAKFPADVAEGVAEVLVTLWKTFVAEDALLVEVNPLVKTKDGRILALDGK
VSLDENADFRQPEHEALEDKAAANPLEAAAKAKNLNYVKLDGEVGIIGNGAGLVMSTLDV
VAYAGENHGGVKPANFLDIGGGASAEVMANGLEIILGDPDVKSVFVNVFGGITACDEVAN
GIVQALELLASKGEEVTKPLVVRLDGNNAELGRKILSDANHPLVQRVDTMDGAADKAAEL
AAAK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgcctcccttgtgacagcgcagtcacgttgccctccgcggcacgcccacgcagac
aacgaaccgcgatcatcagaaaagggacggacgcgcgtggacctgttcgagtaccaggcg
agggacctcttcgccaagcacggagtaccggtgctggccggtgaagtcatcgacacgcct
gaggccgcgcgcgccgcgaccgagcgcctcggcggcaagtccgtcgtcaaggcgcaggtg
aaggtcggtggccgcggcaaggccggcggcgtcaagctggccgccgacgcggacgaggcc
gtcgcccgcgcgacggacatcctcgggatggacatcaagggccacacggtccacaaggtg
atgatcgccgagctgtccccggagatcgaggcggagtactacgtctcgtacctcctcgac
cgcaccaaccgcaccttcctggccatggcctcggtgcagggcggcatggacatcgaggag
gtcgcggagaagacccccgaggccctcgcgaaggtcccggtcaacgccaacgacggcgtc
accctggagaaggcccgcgagatcgtcgcccaggcgaagttcccggccgacgtcgccgag
ggtgtcgccgaggtcctggtcaccctgtggaagaccttcgtcgccgaggacgcgctcctc
gtcgaggtcaacccgctggtgaagaccaaggacggccgcatcctggcgctggacggcaag
gtctcgctcgacgagaacgccgacttccgtcagcccgagcacgaggccctcgaggacaag
gccgcagccaacccgctcgaggctgccgccaaggccaagaacctcaactacgtcaagctc
gacggcgaggtcggcatcatcggcaacggcgccggcctggtcatgtcgaccctggacgtc
gtcgcgtacgccggtgagaaccacggcggcgtgaagccggccaacttcctcgacatcggt
ggcggcgcctccgccgaggtcatggcgaacggcctggagatcatcctgggcgacccggac
gtcaagtccgtgttcgtcaacgtcttcggtggcatcaccgcctgtgacgaggtcgccaac
ggcatcgtccaggccctcgagctcctcgcctccaagggcgaagaggtcaccaagccgctg
gtcgtgcgcctcgacggcaacaacgcggagctgggtcgcaagatcctgtcggacgcgaac
cacccgctcgtgcagcgcgtggacaccatggacggcgcggccgacaaggccgccgagctc
gcggctgcgaagtaa

DBGET integrated database retrieval system