KEGG   Streptomyces venezuelae: SVEN_4536Help
Entry
SVEN_4536         CDS       T02274                                 

Definition
Beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sve  Streptomyces venezuelae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SVEN_4536
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SVEN_4536
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SVEN_4536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4889209..4890855
Genome map
AA seq 548 aa AA seqDB search
MMRYSIRDRRGPHQGPALLATAVALATVAACSSGSPHSSDTSAASPSGPPSGTSASAAPS
SAPPSPTPTPSRTYPLSTAPRTIPSVREHQAARGPGWKPAAPAGVVVGAGSAGLADEGKL
LAGELGIPYRGAVAAGPGDVELALGGTGAPESYTLTVQGGRVRISGPDEAGVFYGTRTLK
QSVKGAGAMPEGVVTDAPAKPQRGLNVDIARKFFSAQWIEDRLREMADLKLNQLGLHFSD
DQGFRIASDSHPEIVSAQHLSKAEVRRVLALAQSLHITVVPEIDSPGHLGAVLRAHPDLQ
LRNVQGTPRQGAIDISKPASARIVDDLLREYSALFPGGWFHVGADEYQALTVRSPSASYP
QLATAARQKYGPQAGVQDLAEGWLNDRAAVVRAAGKTAKAWNDGFFRGGVVTGDKRIEVE
YWTGKEIGARPPAEYLAEGRRVVNLNDEYLYYVLGQPNDFTYPTGRRIYEQWTPLVLRGT
TPVPARYAPQILGARFAVWCDLANAQTPTQVATGIRMPLTALAQKTWDADRPTLTWDQFR
ALAAQVRG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggtactccatacgagacagacgaggccctcaccagggccccgcactcctggcg
acggcggtggcactggccaccgtggcggcctgttcgagcggatcaccccacagctcggac
acctccgccgcctcaccctccggcccgccctccggtacgtcggcgagcgccgcgcccagc
agcgcgccgcccagcccgacgcctacgccgagccggacctacccgctctccaccgccccg
cgcaccatcccctcggtccgcgagcaccaggccgcccgcggccccggctggaagcccgcg
gcccccgccggagtcgtcgtcggcgcgggcagcgcgggcctcgccgacgaggggaagctg
ctcgccggggaactcggcatcccgtaccgcggcgccgtcgccgccgggcccggcgacgtc
gagctcgccctgggcgggaccggcgcgcccgagtcgtacaccctgaccgtccaaggcggg
cgggtccggatcagcgggcccgacgaggccggggtcttctacggcacccgcaccctcaag
cagtccgtgaagggcgccggcgcgatgcccgagggcgtcgtcaccgacgcgcccgccaag
ccgcagcgcggcctcaacgtcgacatcgcccgcaagttcttcagcgcgcagtggatcgag
gaccggctccgtgagatggccgacctcaagctgaaccagctgggcctgcacttctccgac
gaccagggcttccggatcgcctccgacagccaccccgagatcgtctccgcccagcacctc
agcaaggccgaggtgcgccgcgtcctcgccctcgcgcagagcctgcacatcaccgtcgtg
cccgagatcgactcgcccggacacctcggcgccgtcctgcgcgcccaccccgacctccag
ctgcgcaacgtgcaggggaccccgcgccagggcgccatcgacatctccaagccggcctcg
gcccggatcgtggacgacctgctgcgcgagtactccgccctcttccccggcggctggttt
cacgtcggcgcggacgagtaccaggcgctgacggtccgcagcccgtccgcctcctacccc
cagctcgccacggccgcccgccagaagtacgggccccaggccggcgtccaggacctggcg
gagggctggctgaacgaccgcgcggccgtcgtgcgcgctgccgggaagacggccaaggcg
tggaacgacgggttcttccggggcggtgtcgtcaccggcgacaagcgcatcgaggtcgag
tactggacgggcaaggagatcggcgcccgcccgcccgcggagtacctggccgagggccgc
cgggtggtgaacctgaacgacgagtacctctactacgtcctgggccagccgaacgacttc
acgtaccccacgggccggcggatctacgagcagtggacccccctggtcctgcgcggcacg
accccggtccccgcccggtacgccccccagatcctcggcgcccgcttcgcggtctggtgc
gacctggcgaacgcccagaccccgacccaggtggcgaccggcatccgcatgcccctgacg
gccctcgcccagaagacctgggacgcggaccggccgacgctgacctgggaccagttcaga
gcgctggcggcacaggtgcgcggctga

DBGET integrated database retrieval system