KEGG   Streptomyces venezuelae: SVEN_4558Help
Entry
SVEN_4558         CDS       T02274                                 

Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sve  Streptomyces venezuelae
Pathway
sve00240  Pyrimidine metabolism
sve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SVEN_4558
Enzymes [BR:sve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SVEN_4558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl DUF2254 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: CCA57844
UniProt: F2RL85
Position
4914177..4915454
Genome map
AA seq 425 aa AA seqDB search
MDVISVIRTKRDKGELSPEQIDWVIDAYTRGAVADEQMSALAMAILLNGMNRAEIARWTA
AMIASGERMNFDSLSRPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRALLSNEEMLHVLDTTGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGSLVLDVKVGTGAFMKNIEDARELASTMVGLGTDSGVKTVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPADVVELTIALAAEMLAAAGIKDADPAKALADGSAM
DHWRRMIAAQGGDPDAALPVAREQHVVTAPSSGVLTRLDAYDIGIAAWRLGAGRARKEDP
VQAGAGVELHAKPGDTVTAGQPLVTLHTDTPEKFDYALQSLGSAWDIAAEGTSFTPNPIV
LDRIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatctccgtcatccgcacgaagcgggacaagggcgagctgagcccggagcag
atcgactgggtcatcgacgcctacacccgcggtgcggtcgccgacgagcagatgtccgcc
ctggccatggccatcctgctgaacggcatgaaccgcgcggagatcgcccgctggacggcg
gcgatgatcgcgagcggcgagcgcatgaacttcgactccctgtcccgcccgaccgccgac
aagcactccaccggcggcgtcggtgacaagatcaccctcccgctcgccccgctcgtcgcc
gcctgcggcgcggccgtcccgcagctctccgggcgcggcctcggccacaccggtggcacg
ctcgacaagctggagtccatccccggctggcgcgcgctgctctccaacgaggagatgctg
cacgtcctcgacaccaccggcgcggtcatctgcgcggcgggcgacggcctcgcccccgcc
gacaagaagctgtacgcgctccgcgacgtcaccggcacggtcgaggcgatcccgctgatc
gcctcctcgatcatgtcgaagaagatcgccgagggcaccggctcgctggtcctcgacgtc
aaggtcggcaccggcgcgttcatgaagaacatcgaggacgcgcgcgagctcgcctcgacg
atggtcggcctcggcaccgacagcggcgtgaagaccgtcgcgctgctcaccgacatgtcc
accccgctcggcctcaccgccggcaacgcccttgaggtccgtgagtcggtcgaggtcctc
gcgggcggcggcccggcggacgtcgtcgagctgacgatcgcgctggcggccgagatgctc
gccgcggccggcatcaaggacgccgacccggcgaaggcactcgcggacggctcggcgatg
gaccactggcggcggatgatcgcggcccagggcggcgacccggacgcggccctcccggtc
gcccgcgagcagcacgtcgtcacggccccgtcgtccggtgtcctcacccgcctcgacgcg
tacgacatcggcatcgccgcctggcgcctgggcgcgggccgcgcccgcaaggaggacccg
gtgcaggcgggcgcgggcgtcgagctccacgccaagccgggcgacacggtgacggcgggc
cagccgctggtgaccctgcacacggacaccccggagaagttcgactacgccctgcagtcg
ctgggctcggcctgggacatcgcggcggagggcacgtccttcaccccgaacccgatcgtg
ctggaccgcatcgcgtaa

DBGET integrated database retrieval system