KEGG   Streptomyces venezuelae: SVEN_4558Help
Entry
SVEN_4558         CDS       T02274                                 

Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sve  Streptomyces venezuelae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SVEN_4558
Enzymes [BR:sve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SVEN_4558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4914177..4915454
Genome map
AA seq 425 aa AA seqDB search
MDVISVIRTKRDKGELSPEQIDWVIDAYTRGAVADEQMSALAMAILLNGMNRAEIARWTA
AMIASGERMNFDSLSRPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRALLSNEEMLHVLDTTGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGSLVLDVKVGTGAFMKNIEDARELASTMVGLGTDSGVKTVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPADVVELTIALAAEMLAAAGIKDADPAKALADGSAM
DHWRRMIAAQGGDPDAALPVAREQHVVTAPSSGVLTRLDAYDIGIAAWRLGAGRARKEDP
VQAGAGVELHAKPGDTVTAGQPLVTLHTDTPEKFDYALQSLGSAWDIAAEGTSFTPNPIV
LDRIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatctccgtcatccgcacgaagcgggacaagggcgagctgagcccggagcag
atcgactgggtcatcgacgcctacacccgcggtgcggtcgccgacgagcagatgtccgcc
ctggccatggccatcctgctgaacggcatgaaccgcgcggagatcgcccgctggacggcg
gcgatgatcgcgagcggcgagcgcatgaacttcgactccctgtcccgcccgaccgccgac
aagcactccaccggcggcgtcggtgacaagatcaccctcccgctcgccccgctcgtcgcc
gcctgcggcgcggccgtcccgcagctctccgggcgcggcctcggccacaccggtggcacg
ctcgacaagctggagtccatccccggctggcgcgcgctgctctccaacgaggagatgctg
cacgtcctcgacaccaccggcgcggtcatctgcgcggcgggcgacggcctcgcccccgcc
gacaagaagctgtacgcgctccgcgacgtcaccggcacggtcgaggcgatcccgctgatc
gcctcctcgatcatgtcgaagaagatcgccgagggcaccggctcgctggtcctcgacgtc
aaggtcggcaccggcgcgttcatgaagaacatcgaggacgcgcgcgagctcgcctcgacg
atggtcggcctcggcaccgacagcggcgtgaagaccgtcgcgctgctcaccgacatgtcc
accccgctcggcctcaccgccggcaacgcccttgaggtccgtgagtcggtcgaggtcctc
gcgggcggcggcccggcggacgtcgtcgagctgacgatcgcgctggcggccgagatgctc
gccgcggccggcatcaaggacgccgacccggcgaaggcactcgcggacggctcggcgatg
gaccactggcggcggatgatcgcggcccagggcggcgacccggacgcggccctcccggtc
gcccgcgagcagcacgtcgtcacggccccgtcgtccggtgtcctcacccgcctcgacgcg
tacgacatcggcatcgccgcctggcgcctgggcgcgggccgcgcccgcaaggaggacccg
gtgcaggcgggcgcgggcgtcgagctccacgccaagccgggcgacacggtgacggcgggc
cagccgctggtgaccctgcacacggacaccccggagaagttcgactacgccctgcagtcg
ctgggctcggcctgggacatcgcggcggagggcacgtccttcaccccgaacccgatcgtg
ctggaccgcatcgcgtaa

DBGET integrated database retrieval system