KEGG   Streptomyces venezuelae: SVEN_4723Help
Entry
SVEN_4723         CDS       T02274                                 

Definition
Polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
sve  Streptomyces venezuelae
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_4723
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_4723
   00520 Amino sugar and nucleotide sugar metabolism
    SVEN_4723
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SVEN_4723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5082552..5083304
Genome map
AA seq 250 aa AA seqDB search
MGSMNVFGVDIGGSGIKGAPVDLERGALAEERHKVLTPQPATPDGVAGCVAEVVEHFGWT
GPVGVTFPGVVTGSTIRTAANVDKSWIGVDAGTLLSERLGGLPVTVLNDADAAGLAEMTY
GAGRGRKGTVIMLTLGTGIGSALFVDGRLVPNTELGHLELKGHDAETRASTKAKEDEDLS
WEHWATRRLRKYLAHVEMLFSPELFIIGGGVSRKADKFLPLIEGIRAEIVPAELQNNAGI
VGAGMAAGAA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgggttccatgaacgtcttcggagtggacatcggcggctcgggcatcaagggcgccccc
gtggacctggagcgcggagcgctcgccgaggagcgccacaaggtactgaccccgcagccc
gccacacccgacggtgtggcgggctgcgtcgcggaggtcgtggagcacttcggctggacc
ggaccggtgggggtgacgttccccggcgtggtcacgggctcgaccatccgcacggcggcg
aacgtcgacaagtcctggatcggcgtggacgccggcacgctgctgagcgagcgcctgggc
ggcctcccggtcaccgtcctgaacgacgccgacgcggccggcctcgcggagatgacgtac
ggcgcgggccggggccgcaagggcaccgtgatcatgctgaccctcggcacgggcatcggc
tcggccctcttcgtcgacggccgcctggtcccgaacacggagctcggccacctggaactc
aagggccacgacgcggagacccgggcgtcgacgaaggccaaggaggacgaggacctcagc
tgggaacactgggcgacccgccgcctgcggaagtacctggcccacgtggagatgctgttc
tcgccggagctgttcatcatcggcggcggggtgagccgcaaggcggacaagttcctgccc
ctgatcgagggcatcagggcggagatcgtcccggcggaactccagaacaacgcggggatc
gtgggagcggggatggcggcgggggcggcgtaa

DBGET integrated database retrieval system