KEGG   Streptomyces venezuelae: SVEN_4740Help
Entry
SVEN_4740         CDS       T02274                                 

Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SVEN_4740
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVEN_4740
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SVEN_4740
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SVEN_4740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5098114..5099250)
Genome map
AA seq 378 aa AA seqDB search
MLIFMTVYVCPRCRAQSPTDALTWCCPHCRGPWDLEFASEPVSLASLASRRNSLWRYEEA
LPPMPYAAEVTLGEGRTPLVPLAEDAEGSVSAKLDFLMPTLSFKDRGAVMLAAHALRLAR
AGRLRRIVADSSGNAGTAVAAYGARAGLDTLVYVPEGTSPKKLAQIRAHGAQVVEVPGDR
EATARAARAAADEPGTFYASHVYNPYFLHGTKTYVYELWEELGGRLPDTIVVPVGNGTLL
LGAALALDELHRHGLTDNRPTLVAVQAEAVSPLAAAFHAGADELGAPAPARPTLAEGIAI
PAPPRAHQILRAVRATGGTFLTVPEDRIRAAQRDLARRGLFVESTGVACWAAVQAAAPRP
GLTVVPLCGAGAKTGLAP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcttcatgaccgtctacgtgtgcccccgctgccgggcccagtcgcccacggac
gcgctcacctggtgttgtccccactgccgtggcccctgggacctggagttcgcgagtgaa
ccggtttccctcgcgtcactcgcgtcacggcgaaattcattgtggcgttacgaggaggcg
ctgccgccgatgccgtacgcggcggaggtgacgctcggagagggccgcacgcccctcgtc
cccctggcggaagacgccgagggatcggtttccgccaaactcgacttcctcatgccgacc
ctgtccttcaaggaccgcggcgccgtcatgctcgccgcccacgccctccgcctcgcccgg
gccggccgcctccgccggatcgtcgccgacagcagcggcaacgcgggcaccgccgtcgcc
gcgtacggcgcgcgggccggactcgacaccctcgtctacgtccccgagggcacctccccc
aagaagctggcacagatccgggcccacggcgcccaggtcgtcgaagtgccaggagaccgc
gaggccacggcccgcgccgcccgcgcggccgccgacgaacccggcaccttctacgcctcg
cacgtgtacaacccgtacttcctgcacggcaccaagacctacgtctacgagctctgggag
gaactcggcggccgcctccccgacacgatcgtcgtcccggtcggcaacggcaccctgctc
ctcggcgccgccctcgccctcgacgaactgcaccgccacgggctcaccgacaaccggccc
acgctcgtcgcggtccaggccgaagccgtctccccgctggccgccgccttccacgccggc
gccgacgaactgggcgcccccgcccccgcccgccccaccctcgccgagggcatcgccatc
ccggccccgccccgcgcccaccagatcctccgggccgtacgggccaccggcggcacgttc
ctgacggtgccggaggaccggatccgggccgcccaacgggacctcgcccgacgcggcctc
ttcgtcgaatccaccggcgtggcctgctgggcggcggtccaggcggccgcaccgcgcccc
ggcctcacggtggtgcccctgtgcggggcgggggcgaagacgggcctggccccctga

DBGET integrated database retrieval system