KEGG   Streptomyces venezuelae: SVEN_4785Help
Entry
SVEN_4785         CDS       T02274                                 

Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sve  Streptomyces venezuelae
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sve01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sve00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5151050..5152144
Genome map
AA seq 364 aa AA seqDB search
MADITPPDAPLDLSQDGAALTAALVDFPSVSGTEQPLADAIEQALRALPHLTVDRYGNNV
VARTRLGRGERVVLAGHIDTVPIADNVPSRLDEDGILWGCGTSDMKSGVAVQLRIAATVP
EPNRDLTFVFYDNEEVAADLNGLGKIAAAHPDWLEGDFAVLLEPSDAQVEGGCQGTLRVI
LHTAGERAHSARSWMGSNAIHTAAPILARLASYEPRKPVIDGLEYHEGLNAVAIQGGVAT
NVIPDACTVTVNYRYAPDRSPAEALEHVREVFADCDIAEFVVDDESPGALPGLSHPAAEA
FMKAVGGSAQPKFGWTDVSRFSALGVPAVNYGPGDPIYAHKRDEHVPVDRIHHCEARLRD
WLTA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatcaccccgcccgacgcgcccctcgacctgtcccaggacggggccgcgctc
accgccgccctcgtcgacttcccgtccgtcagcgggaccgagcagccgctcgcggacgcc
atcgagcaggcgctgcgcgcactgccgcacctcaccgtcgaccgctacgggaacaacgtc
gtcgcccgcacccggctcggccgcggcgagcgggtcgtcctggcggggcacatcgacacc
gtgccgatcgccgacaacgtgccctcgcggctcgacgaggacggcatcctgtggggctgc
ggcacctccgacatgaagtccggggtcgccgtccagctgcggatcgccgccaccgtcccc
gagcccaaccgcgacctcaccttcgtcttctacgacaacgaggaggtcgccgccgacctc
aacggcctcgggaagatcgccgccgcgcaccccgactggctggagggcgacttcgccgtc
ctcctggagccctcggacgcccaggtcgagggcggctgccagggcacgctccgggtgatc
ctgcacaccgcgggggagcgggcccactccgcgcgctcctggatgggctccaacgccatc
cacacggccgccccgatcctcgcccgcctcgcctcgtacgagccgcgcaagccggtcatc
gacggcctggagtaccacgagggcctgaacgccgtcgcgatccagggcggcgtcgccacc
aacgtcatccccgacgcgtgcacggtcacggtcaactaccggtacgcccccgaccgctcc
ccggccgaggccctggagcacgtccgcgaggtcttcgcggactgcgacatcgccgagttc
gtcgtcgacgacgagagccccggcgcgctgcccggcctctcccacccggcggccgaggcc
ttcatgaaggccgtcgggggcagcgcccagcccaagttcggctggaccgacgtgtcccgc
ttcagcgccctcggcgtcccggccgtcaactacggtcccggcgaccccatctacgcgcac
aagcgggacgagcacgtgcccgtggaccgcatccaccactgcgaggcacgcctccgcgac
tggctgaccgcctga

DBGET integrated database retrieval system