KEGG   Streptomyces venezuelae: SVEN_4787Help
Entry
SVEN_4787         CDS       T02274                                 

Definition
Non functional Dihydropteroate synthase 2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sve  Streptomyces venezuelae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sve00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5153084..5153944)
Genome map
AA seq 286 aa AA seqDB search
MLRLGRREFGPHEPVIMAIVNRTPDSFYDQGATFRDEPALARVEQAVAEGAAIIDIGGVK
AGPGEEVTAEEEARRTVGFVAEVRRRHPDVVISVDTWRADVGEAVCEAGADVLNDAWGGV
DPGLAEVAAKYGAGLVCTHAGGAEPRTRPHRVEYEDVMADILRVTVGLAERAASLGVRRD
AIMIDPGHDFGKNTRHSLEATRRLGEMTETGWPVLVSLSNKDFVGETLDRPVKERVLGTL
ATTAVSAWLGAQVYRVHEVAETRQVXXMVASIAGHRAPAVARRGLA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttgggacggcgtgaattcgggccgcacgagccggtgatcatggcgatcgtg
aaccggaccccggactccttctacgaccagggcgcgaccttccgggacgagcccgcgctc
gcccgcgtcgagcaggcggtcgccgagggcgccgcgatcatcgacatcggcggggtcaag
gcgggccccggcgaggaggtcacggccgaggaggaggcgcgccgcacggtcggcttcgtc
gcggaggtccgcaggcgccaccccgacgtggtcatcagcgtggacacctggcgcgcggac
gtcggcgaggcggtctgcgaggccggcgcggacgtcctgaacgacgcgtggggcggggtc
gacccggggctcgccgaggtcgccgcgaagtacggtgcgggcctggtgtgcacccacgcg
ggcggcgcggagcctcggacgcggccgcaccgggtcgagtacgaggacgtcatggccgac
atcctgcgggtcaccgtcggactcgcggagcgcgcggcctcgctcggggtgcggcgggac
gcgatcatgatcgacccgggtcacgacttcgggaagaacacccggcacagcctcgaggcg
acgcggcggctcggggagatgacggagacgggctggccggtgctggtgtccctgtcgaac
aaggacttcgtcggcgagacgctggaccggccggtgaaggagcgggtcctcgggaccctg
gcgacgaccgccgtgtcggcgtggctgggcgcccaggtgtaccgggtgcacgaggtcgcc
gagacgcggcaggtgnnnnacatggtcgcgtccatcgcgggccaccgggcgccggccgtc
gcgcgacgcgggctggcgtag

DBGET integrated database retrieval system