KEGG   Streptomyces venezuelae: SVEN_5007Help
Entry
SVEN_5007         CDS       T02274                                 

Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SVEN_5007
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVEN_5007
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SVEN_5007
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SVEN_5007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5390764..5391834
Genome map
AA seq 356 aa AA seqDB search
MTHKGTHQWRGIIEEYRDRLPVTDTTPVVTLREGGTPLVPAQVLSERTGCEVHLKVEGAN
PTGSFKDRGMTMAISKAKEEGAQAVICASTGNTSASAAAYAVRAGMVSAVLVPQGKIALG
KMGQALVHGAKILQVDGNFDDCLTLARALSENYPVALVNSVNPVRIEGQKTAAFEIVDML
GDAPDIHVLPVGNAGNITAYWKGYREYAADGLATHRPRMWGFQASGSAPLVRGEVVKDPS
TIATAIRIGNPASWDYAIAARDESGGFIDEVTDREILQAYRLLASQEGVFVEPASAASVA
GLLKAAAQGKVDPGQRIVCTVTGNGLKDPDWAVAGAPQPVTVPVDAAAAAERLGLA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacccacaagggcacccaccagtggcgcggcatcatcgaggagtaccgggaccgcctt
ccggtcacggacacgacgccggtcgtcacgctccgtgagggcggcacgccgctcgtaccc
gctcaggtcctctccgagcgcacgggctgcgaggtgcacctcaaggtcgagggcgccaac
cccaccggctccttcaaggaccgcggcatgaccatggccatctccaaggccaaggaggag
ggggcgcaggccgtcatctgcgcctccaccggcaacacctccgcctccgccgcggcctac
gcggtgcgcgccgggatggtgtcggccgtcctcgtgccgcagggcaagatcgcgctcggc
aagatgggccaggccctcgtgcacggcgcgaagatcctccaggtcgacggcaacttcgac
gactgcctcaccctggcccgcgcgctctccgagaactacccggtggcgctggtcaattcg
gtgaacccggtccgcatcgagggccagaagaccgcggccttcgagatcgtggacatgctg
ggcgacgcgcccgacatccacgtgctgcccgtgggcaacgccggcaacatcacggcgtac
tggaaggggtaccgcgagtacgccgcggacggcctcgcgacgcaccgcccgcgcatgtgg
ggcttccaggcctccggctccgccccgctggtgcgcggcgaggtcgtcaaggacccgtcg
acgatcgccaccgcgatccggatcggcaacccggcctcgtgggactacgcgatcgccgcg
cgcgacgagtcgggcggcttcatcgacgaggtgacggaccgtgagatcctgcaggcctac
cgcctgttggcctcgcaggagggcgtcttcgtggagcccgcgtcggccgcctcggtggcc
ggtctgctgaaggccgccgcgcagggcaaggtcgaccccggccagcggatcgtctgcacg
gtcaccggcaacggcctcaaggaccccgactgggccgtcgccggcgcgccgcagccggtc
accgtcccggtcgacgcggccgccgccgccgagcgcctcggtctggcctga

DBGET integrated database retrieval system