KEGG   Streptomyces venezuelae: SVEN_5078Help
Entry
SVEN_5078         CDS       T02274                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sve  Streptomyces venezuelae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_5078
   01230 Biosynthesis of amino acids
    SVEN_5078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_5078
   00030 Pentose phosphate pathway
    SVEN_5078
   00051 Fructose and mannose metabolism
    SVEN_5078
   00052 Galactose metabolism
    SVEN_5078
  Energy metabolism
   00680 Methane metabolism
    SVEN_5078
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SVEN_5078
Protein phosphatases and associated proteins [BR:sve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SVEN_5078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5466053..5467078
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTAGGDCPGLNAVIRSVVHRALTGHDDEVIGFEDGFKGLLDGHYRPLDLNAVSGI
LARGGTILGSARLERNRLAEAAESAPDLAREYGIDVLIPIGGEGTLTAARMLSDAGMPVV
GVPKTIDNDISSTDRTFGFDTAVGVATEAMDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAGGAHGICLPERPFQVDDLVKMVEERFARGKKFAVICVAEGAHPAEGSMEYQKGEIDQ
FGHERFQGIGNQLAVELERRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GEFGKMTALRGTGVEMVPLAEAVTQLKRVPEDRMREAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagttctcaccgcaggcggcgactgccccggcctgaacgcagtgatccgg
tcggtcgtgcaccgggcgctgaccggccacgacgacgaagtcatcggcttcgaggacggg
ttcaagggcctcctcgacggccactaccgccccctcgacctcaacgccgtcagcggcatc
ctggcccgcggcggcaccatcctcggctccgcccgcctggagcggaaccggctcgccgaa
gccgccgaatccgcccccgacctggcccgcgagtacggcatcgacgtcctcatcccgatc
ggcggcgaaggcaccctgaccgccgcgcggatgctctccgacgccggcatgcccgtcgtc
ggcgtcccgaagacgatcgacaacgacatctcctccacggaccgcaccttcggcttcgac
accgccgtcggcgtcgccaccgaggcgatggaccgcctcaagaccaccgccgagtcccac
cagcgcgtgatggtcgtcgaggtgatgggccgccacgccggctggatcgccctggagtcc
ggcatggccggcggcgcgcacggcatctgcctgcccgagcggcccttccaggtcgacgac
ctggtcaagatggtcgaggagcgcttcgcccgcggcaagaagttcgccgtcatctgcgtc
gccgagggcgcccatccggccgagggctcgatggagtaccagaagggcgagatcgaccag
ttcggccacgagcgcttccagggcatcggcaaccagctcgccgtcgagctggaacggcgc
ctcggcaaggaggcccgcccggtcatcctcggccacgtccagcgcggcggcacgccgacc
gcgtacgaccgggtgctcgccacccgcttcggctggcacgcggtggaggcggcgcaccgg
ggcgagttcggcaagatgacggcgctgcggggcacgggcgtcgagatggtgccgctggcc
gaggccgtgacccagctcaagagggtccccgaggaccgcatgcgcgaggccgagtcggtc
ttctag

DBGET integrated database retrieval system