KEGG   Streptomyces venezuelae: SVEN_5094Help
Entry
SVEN_5094         CDS       T02274                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sve  Streptomyces venezuelae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sve00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5483404..5485716)
Genome map
AA seq 770 aa AA seqDB search
MTARPVGKTARSSKAPKAAQAEKATTKPRAPKAPKAPRTAPPIDPGDRARLLAGEHHDPH
GVLGAHPVRGGVAVRVLRPWAKEVTVVTKGKRVPLRHEGDGIFSGLLPLLRKVPAYELRV
RYGDDASDELALHDPYRFLPSLGDLDLHLIGEGRHEELWTALGSHVMTHDGVTGTRFAVW
APNARGVRVTGDFTHWDGTGLPMRSLGSTGVWELFVPGIGEGALYKYDITRPDGTHTVRA
DPMARRTECPPNTASIVTASHYTWDDAEWMRRRGDRPPHEAPISVYEVHLPSWRPGLTYR
QLAEQLPAYVRDLGFTHVELMPVTEHPFGGSWGYQVTGFYAPTARMGTPDDFRFLVDALH
RAGIGVLMDWVPAHFPKDDWALAEFDGRPLYEHEDPRRSHHPDWGTLEFDYGRKEVRNFL
VANAVYWCQEFHIDGLRVDAVASMLYLDYSREHGEWLPNEFGGRENLDAVRFLQEMNATV
YRRCPGVVTFAEESTAWDGVTRPTDQVGAGGFGGLGFGMKWNMGWMHDSLEYMQKEPVHR
KYHHHEMTFSMVYAYSENYILPISHDEVVHGKRSLVSKMPGDWWQQRANHRAYLGFMWAH
PGKQLLYMGQEFAQGAEWSADHGPDWWLLDPAYGAEPDHRGVRDLVRDLNTVYAATPSLW
ERDTAPEGFQWVVGDAAEDNVFAFLRFDAFGSPLLAVSNFSPVVRHDYRLGVPDQVVAWA
EVLNTDAGRYGGGDVVGRDPLKTESVPHHGRSASIRMTLPPLATVWLRPA
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccgccccgtaggcaagacggcccgcagcagcaaggcccccaaggccgcgcag
gccgagaaggccaccacgaagccccgggcgcccaaggccccgaaggcgcccaggaccgcg
ccaccgatcgatccgggcgaccgggcccggctgctcgccggggagcaccacgatccgcac
ggggtgctcggcgcgcatccggtccggggcggcgtcgcggtccgggtgctgcgcccgtgg
gcgaaggaggtgacggtcgtcaccaagggcaagcgggtcccgctccgccacgagggcgac
gggatcttctccgggctgctccccctcctgcgcaaggtcccggcgtacgagctgcgcgtg
cggtacggcgacgacgcctccgacgagctcgccctccacgacccgtaccgcttcctgccg
tcgctcggcgacctcgacctgcacctgatcggcgagggccggcacgaggagctgtggacg
gcgctcggctcgcacgtcatgacgcacgacggcgtcaccggcacccgcttcgcggtctgg
gcgccgaacgcccgcggcgtccgggtcaccggtgacttcacgcactgggacggcacgggc
ctgccgatgcgctcgctgggttcgacgggcgtgtgggagctgttcgtgccgggcatcggc
gagggcgcgctctacaagtacgacatcacccggcccgacggcacgcacacggtccgcgcg
gacccgatggcccgccgcacggaatgcccgccgaacaccgcgtcgatcgtcaccgcctcg
cactacacgtgggacgacgcggagtggatgcggcggcgcggggaccgcccgccgcacgag
gcgccgatctccgtctacgaggtccacctgccctcctggcgccccggactgacctaccgt
cagctcgccgagcagctccccgcgtacgtccgcgacctcggcttcacgcacgtggagctg
atgccggtcaccgagcaccccttcggcggctcctggggctaccaggtcaccggcttctac
gcgccgacggcccgcatgggcacccccgacgacttccgcttcctggtggacgcgctgcac
cgggcggggatcggcgtcctgatggactgggtgccggcgcacttcccgaaggacgactgg
gcgctggccgagttcgacgggcgcccgctgtacgagcacgaggacccgcgccgctcgcac
catcccgactggggcaccctggagttcgactacggccgcaaggaggtgcggaacttcctg
gtggccaacgcggtgtactggtgccaggagttccacatcgacggtctgcgggtggacgcg
gtggcctcgatgctctacctcgactactcgcgggagcacggcgagtggctgccgaacgag
ttcggcggtcgggagaacctggacgcggtgcgcttcctccaggagatgaacgccaccgtc
taccgccgctgccccggcgtcgtcaccttcgccgaggagtcgaccgcctgggacggggtg
acgcggccgaccgaccaggtgggagcgggcggcttcggtggtctgggcttcggcatgaag
tggaacatgggctggatgcacgactcgctggagtacatgcagaaggagccggtgcaccgg
aagtaccaccaccacgagatgaccttctcgatggtgtacgcgtacagcgagaactacatc
ctgccgatctcccacgacgaggtcgtgcacggcaagcggtccctggtgtcgaagatgccg
ggcgactggtggcagcagcgggccaaccaccgcgcctacctgggcttcatgtgggcccat
ccgggcaagcaactgctctacatggggcaggagttcgcgcagggcgcggagtggtcggcg
gaccacgggccggactggtggctgctggacccggcgtacggcgcggagccggaccaccgg
ggcgtgcgggatctcgtccgggacctgaacacggtctacgcggcgacgccctcgctctgg
gagcgggacaccgccccggaggggttccagtgggtggtgggggacgcggcggaggacaac
gtcttcgcgttcctgcgcttcgacgccttcggctcgccgctgctcgccgtctcgaacttc
tcgccggtcgtccggcacgactaccggctcggcgtgccggaccaggtggtcgcctgggcg
gaggtgctgaacacggacgccggccggtacggcggcggggacgtggtggggcgcgatccg
ctgaagacggagtcggtgccgcaccacgggcgttcggccagcatccggatgacgctgccg
ccgctcgcgacggtctggctgcggcccgcgtga

DBGET integrated database retrieval system