KEGG   Streptomyces venezuelae: SVEN_5215Help
Entry
SVEN_5215         CDS       T02274                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sve  Streptomyces venezuelae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SVEN_5215
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SVEN_5215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5637042..5637668)
Genome map
AA seq 208 aa AA seqDB search
MTGPRGVVLFGPPAAGKDTVSAALNVLDTRFAQLVKVKVGSGRTAGYRMATEEELGSLRA
AGRIVLETERYGNTYAVDRADLDEMRAAGGFPVVHVGSLAHLRTFLRSVGEPWLRVLLWI
PRQECALRSAGRGDCDTEERLGVWDATLEDLAAADPDEALFHLLLRTDLRSPEETAAAVT
EAVAAGAERPRSGRELVAFLREQASHGH
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcccccgtggagtggtgctcttcggtccccccgcggccggaaaggacaccgtc
agcgccgcgctgaacgtgctcgacacccggttcgcgcaactggtgaaggtgaaggtgggc
tccggccggaccgccgggtaccgcatggccacggaggaggagctcggctcgctgcgggcg
gccggacggatcgtcctggagacggagcgctacggcaacacgtacgccgtggaccgcgcc
gatctcgacgagatgagggcggcgggcgggttcccggtggtgcacgtgggcagcctcgcg
catctgcgaaccttcctgcgttcggtgggcgaaccatggctccgtgtactgctctggatc
ccccgccaggaatgcgccctcaggtccgcgggacgcggcgactgtgacacagaagaacgc
ctgggcgtctgggacgcgacgcttgaggacctggcggccgccgacccggacgaggcactg
ttccacctcctgcttcgcaccgacctgcggtcccctgaagagacggccgcggccgtgacg
gaggccgtcgccgccggagccgagcggccgaggtccgggcgggaactcgtcgcgtttctc
cgtgaacaggcctcgcacggccactga

  All links  
No link information was found.   
DBGET integrated database retrieval system