KEGG   Streptomyces venezuelae: SVEN_5266Help
Entry
SVEN_5266         CDS       T02274                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sve  Streptomyces venezuelae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sve03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5690929..5691789
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEVVRRGLERWVAGRTVTEVEVLHPRAVRRHPAGGADFAARLTGQRFEVARRRG
KYLWLPLAESGTSVLGHLGMSGQLLVQPEGAADEKHLRIRIRFDDSAGTELRFVDQRTFG
GLSLHDQTPAGLPDVIGHIARDPLDPEFDDAAFQSALRLRRTTVKRALLDQSLISGVGNI
YADEALWRSRLHYDRPTATLTRPRSAELLGHIRDVMNAALAVGGTSFDSLYVNVNGESGY
FDRSLDAYGREDEPCRRCGTPMRRRAWMNRSSYFCPRCQRPPRPTV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagctgcccgaggtcgaggtcgtacggcgcggtctggagcgctgggtcgccggg
cggaccgtgaccgaggtcgaggtcctgcaccccagggccgtacggcgccatcccgcgggc
ggcgcggacttcgcggcccggctgaccgggcagcgcttcgaggtggcacggcggcgcggc
aagtacctctggctgccgctcgccgagagcggcacctccgtcctcgggcacctcggcatg
agcgggcagctgctcgtccagccggagggcgccgccgacgagaagcacctgcgcatccgg
atccgcttcgacgactccgccggcaccgagctgcgcttcgtcgaccagcggaccttcggc
ggactctcgctgcacgaccagacccccgccgggctgccggacgtcatcgggcacatcgcg
cgcgacccgctggaccccgagttcgacgacgccgccttccagagcgcgctgcggctgcgc
cgcaccaccgtcaagcgggcgctgctcgaccagtcgctgatcagcggcgtcggcaacatc
tacgccgacgaggcgctctggcggtcccggctgcactacgaccggccgacggccaccctg
accaggccgcgctcggcggaactcctcggccacatcagggacgtgatgaacgcggccctc
gcggtcggcgggaccagcttcgacagcctgtacgtgaacgtgaacggcgagtccggctac
ttcgaccgctcgctcgacgcctacggccgcgaggacgagccgtgccgccgctgcggtacg
ccgatgcggcgccgggcatggatgaaccgctccagctacttctgcccgcgctgccagcgg
ccgccgcgccccaccgtctga

DBGET integrated database retrieval system