KEGG   Streptomyces venezuelae: SVEN_5832Help
Entry
SVEN_5832         CDS       T02274                                 

Definition
Protoporphyrinogen IX oxidase, aerobic (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sve  Streptomyces venezuelae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sve00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6351987..6353486
Genome map
AA seq 499 aa AA seqDB search
MNADTTGQHAVPHVVVVGGGIAGLAAAHRLAHAGHRVTLLEADDRLGGKLLAGEIAGAPV
DLGAESLLARRPEAVSLARAVGLGDRLQAPATTTASVWSRGELVPMPKGHVMGVPGTPEA
VEGLLSAEGVRRIGGDLELPPTEIGDDIAIGAYVAARMGHEVVDRLVEPLLGGVYAGDAH
RISMKAAVPALFEAARAHPTLTAAVHAVQRAGAATPADAAGAANGLGGSVFLGIEGGIGT
LPGAVADAVRTAGGEVLTGVPVQTLVRSGATGWQVVTRHRTFDADAVVLATPAGVAAALV
GGHAPAAGAELDAIDYASMALVTLAFRRSDMPELAGSGFLVPPVDGHTVKASTFSSQKWR
WVSDGAPGLFVLRTSVGRHGEEEQVHREDSDLVAASLKDLAAATGLAAHPVASTVTRWIG
GLPQYPVGHLDRVARIRAGVAALPGLRLAGAAYDGVGIPACISSAHRAADEIAGELARRR
GEEIIATSKTGDPGAGHSL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggacaccacgggacagcacgccgtgcctcatgtcgtcgtcgtcggaggcggg
atcgccggactcgcggccgcccaccggctggcccacgccggccaccgggtgaccctcctc
gaagccgacgaccggctcggcggcaagctcctcgccggggagatcgccggcgcccccgtg
gacctcggcgccgagtccctgctcgcccgccgccccgaggccgtctccctcgcccgggcc
gtcggcctcggcgaccgcctccaggccccggccaccaccaccgcgtccgtctggtcccgc
ggcgagctcgtcccgatgcccaagggacacgtcatgggcgtccccggcacccccgaggcc
gtcgaggggctcctgtccgccgagggcgtgcggcgcatcggcggcgacctggagctgccg
cccaccgagatcggcgacgacatcgccatcggcgcgtacgtcgccgcgcgcatgggccac
gaggtcgtcgaccggctcgtcgaacccctcctcggcggggtgtacgcgggcgacgcccac
cgcatctcgatgaaggccgccgtccccgccctcttcgaggccgcccgggcccaccccacg
ctcaccgccgccgtccacgccgtccagcgggccggcgccgccacccccgccgacgcggcg
ggcgccgccaacggcctcggcggctccgtcttcctcggcatcgagggcggcatcggcacg
ctccccggcgcggtcgccgacgccgtccgcaccgccggcggcgaggtcctcaccggcgtg
cccgtgcagacgctggtccgttccggcgccaccggctggcaggtcgtcacccggcaccgg
acgttcgacgccgacgccgtcgtcctcgccacccccgccggcgtcgccgccgcgctcgtc
ggcggccacgccccggccgccggggccgagctcgacgcgatcgactacgcctccatggcg
ctggtcaccctcgccttccgccgctccgacatgcccgagctggccggctccggcttcctg
gtgccgcccgtcgacggacacaccgtcaaggcctccacgttctcctcgcagaagtggcgc
tgggtctccgacggagcccccggcctgttcgtgctgcgcacctccgtcggccggcacgga
gaggaggagcaggtccaccgcgaggactccgacctcgtcgccgcctccctcaaggacctc
gccgccgccaccggactcgccgcacacccggtggcgagcacggtcacccgctggatcggc
gggctgccccagtacccggtcggccacctcgaccgcgtcgcccgcatccgcgcgggcgtc
gccgccctccccggactgcggctcgcgggcgccgcgtacgacggcgtcggcatccccgcc
tgcatctcctcggcgcaccgtgcggcggacgagatcgcgggggagctggcgcggcggcgg
ggcgaggagatcatcgccacgtcgaaaacgggcgaccccggtgcggggcactccctgtga

DBGET integrated database retrieval system