KEGG   Streptomyces venezuelae: SVEN_5999Help
Entry
SVEN_5999         CDS       T02274                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
  KO
K16438  
5-epimerase [EC:5.1.3.-]
Organism
sve  Streptomyces venezuelae
Pathway
Staurosporine biosynthesis
Polyketide sugar unit biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SVEN_5999
   01055 Biosynthesis of vancomycin group antibiotics
    SVEN_5999
  Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    SVEN_5999
Enzymes [BR:sve01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     SVEN_5999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6528492..6529100
Genome map
AA seq 202 aa AA seqDB search
MTTTMQVTPLAIEGAFAFTPPVFKDSRGLFASPYQGDVFAGQLGRPLFQVEQVSHNLSAR
GTLRGVHFTATPPGMAKYVYCPYGRLRDFLIDLRVGSPTFGQWVMNELDAETSRALYVPV
GVGHAFVSLQDDSMCVYVMSQGYVPANELALNPLDPALGLDLPDDVELILSDRDKIAPTL
AEARDRGLLPDFDTCRKLEELL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgaccatgcaggtgacccccctggccatcgagggcgccttcgccttcacgccc
cccgtcttcaaggacagccgcggcctgttcgcctccccctaccagggggacgtgttcgcc
gggcagctcggccgcccgctcttccaggtcgaacaggtcagccacaacctgtccgccagg
ggcaccctccgcggcgtccacttcaccgcgaccccgccgggcatggcgaagtacgtctac
tgcccgtacggcaggctccgggacttcctcatcgacctccgggtcggctcaccgaccttc
gggcagtgggtgatgaacgaactcgacgcggagaccagccgcgccctctacgtcccggtc
ggcgtcggccacgcgttcgtctcgctccaggacgactccatgtgcgtctacgtgatgtcg
caggggtacgtccccgccaacgaactggccctgaacccgctcgacccggcgctcggactc
gacctgccggacgacgtcgagctgatcctgtccgaccgggacaagatcgcccccaccctc
gccgaggcccgcgaccgcggcctcctgcccgacttcgacacctgccgcaagctggaggaa
ctgctgtga

DBGET integrated database retrieval system