KEGG   Streptomyces venezuelae: SVEN_5999Help
Entry
SVEN_5999         CDS       T02274                                 

Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6528492..6529100
Genome map
AA seq 202 aa AA seqDB search
MTTTMQVTPLAIEGAFAFTPPVFKDSRGLFASPYQGDVFAGQLGRPLFQVEQVSHNLSAR
GTLRGVHFTATPPGMAKYVYCPYGRLRDFLIDLRVGSPTFGQWVMNELDAETSRALYVPV
GVGHAFVSLQDDSMCVYVMSQGYVPANELALNPLDPALGLDLPDDVELILSDRDKIAPTL
AEARDRGLLPDFDTCRKLEELL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgaccatgcaggtgacccccctggccatcgagggcgccttcgccttcacgccc
cccgtcttcaaggacagccgcggcctgttcgcctccccctaccagggggacgtgttcgcc
gggcagctcggccgcccgctcttccaggtcgaacaggtcagccacaacctgtccgccagg
ggcaccctccgcggcgtccacttcaccgcgaccccgccgggcatggcgaagtacgtctac
tgcccgtacggcaggctccgggacttcctcatcgacctccgggtcggctcaccgaccttc
gggcagtgggtgatgaacgaactcgacgcggagaccagccgcgccctctacgtcccggtc
ggcgtcggccacgcgttcgtctcgctccaggacgactccatgtgcgtctacgtgatgtcg
caggggtacgtccccgccaacgaactggccctgaacccgctcgacccggcgctcggactc
gacctgccggacgacgtcgagctgatcctgtccgaccgggacaagatcgcccccaccctc
gccgaggcccgcgaccgcggcctcctgcccgacttcgacacctgccgcaagctggaggaa
ctgctgtga

DBGET integrated database retrieval system