KEGG   Streptomyces venezuelae: SVEN_6077Help
Entry
SVEN_6077         CDS       T02274                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sve  Streptomyces venezuelae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_6077
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_6077
   00620 Pyruvate metabolism
    SVEN_6077
   00640 Propanoate metabolism
    SVEN_6077
  Energy metabolism
   00680 Methane metabolism
    SVEN_6077
Enzymes [BR:sve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SVEN_6077
Lipid biosynthesis proteins [BR:sve01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SVEN_6077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6617194..6618879
Genome map
AA seq 561 aa AA seqDB search
MTANSATSATERFRAARDFLLRHREDYETAYEGFAWPRSERFNWALEWFDVIAEGNDRTA
LHLVEEDGEETRVSFADMSARSNRVANWLRAQGVRAGDRIIVMLGNQVELWETVLAAMKL
RAVVIPATPLLGPADLRDRVDRGRARHVIVRAEDTAKFDDVPGDYTRIAVGGDGVSWLGY
EHAADASEVFEPEGVTLTDDTLMLYFTSGTTARPKLVEHTHTSYPVGHLSTMYWIGLKPG
DVHLNISSPGWAKHAWSNLFAPWNAEATVFIHNYTRFDPARLMGEMERHGVTSFCAPPTV
WRMLIQADLSQLKTPPREVVAAGEPLNPEVIESVRRAWGVTIRDGFGQTETAVQVSNSPG
QRLKEGSMGRPSPGFQVTLVDPVTGEADVPEGEICLDLSANPVGLMTGYHGDPERTAEAM
AGGYYRTGDIGARDQDGYITYIGRSDDVFKASDYKISPFELESALLEHEAVAEAAVVPAP
DPLRLAVPKAYVVLAAGWEPDAETAKALFAHSRAVLAPYKRVRRIEFAELPKTVSGKIRR
VELRRLTAEGGGKEYVEGDLG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaacagcgcgaccagtgcgacggagaggttccgggccgcccgggacttcctg
ctccggcaccgcgaggactacgagacggcctacgagggcttcgcctggccccggtccgag
cggttcaactgggcgctcgaatggttcgacgtcatcgccgaggggaacgaccgcaccgcg
ctccacctcgtcgaggaggacggcgaggagaccagggtcagcttcgccgacatgtccgcc
cgctccaaccgcgtcgcgaactggctgcgcgcccagggcgtccgcgccggtgaccggatc
atcgtcatgctgggcaaccaggtcgagctgtgggagaccgtcctcgccgcgatgaagctg
cgcgcggtcgtcatccccgccaccccgctgctcggccccgccgacctgcgcgaccgcgtc
gaccggggccgcgcccgccatgtgatcgtgcgcgccgaggacaccgccaagttcgacgac
gtcccgggcgactacacccggatcgcggtcggcggcgacggggtgagctggctggggtac
gagcacgccgccgacgcgtccgaggtgttcgagccggagggcgtcaccctcaccgacgac
accctgatgctgtacttcacctccggcacgaccgcccgtccgaagctcgtcgagcacacc
cacacctcgtacccggtcgggcacctgtcgacgatgtactggatcggcctcaagcccggc
gacgtgcacctcaacatctcttcgcccggctgggccaagcacgcctggtccaacctcttc
gccccctggaacgccgaggcgaccgtcttcatccacaactacacgcgcttcgacccggcc
cgtctcatgggcgagatggagcggcacggcgtcaccagcttctgcgccccgccgaccgtg
tggcggatgctgatccaggccgacctgagccagctgaagaccccgccgcgcgaggtcgtc
gccgcaggcgaacccctcaaccccgaggtcatcgagtcggtacgccgggcctggggcgtc
accatccgggacggcttcggccagacggagaccgccgtccaggtctccaacagtccgggg
cagcggctcaaggagggctccatgggccgcccgagccccggcttccaggtcaccctcgtc
gacccggtgaccggcgaggccgacgtgccggagggcgagatctgcctcgacctgtcggcc
aacccggtgggcctgatgaccggttaccacggcgatccggagcgtacggcggaggccatg
gccggcggctactaccgcaccggtgacatcggtgcgcgagaccaagacggatacatcacg
tacatcgggcgcagtgacgacgtcttcaaggcgtccgactacaagatcagccccttcgag
ctggagagcgcgctgctggagcacgaggccgtcgccgaggcggccgtcgtccccgccccc
gacccgctgcggctcgccgtccccaaggcgtacgtcgtcctcgcggccggctgggagccg
gacgccgagacggcgaaggccctcttcgcccactcgcgcgcggtcctggccccgtacaag
cgggtccggcgcatcgagttcgccgagctgccgaagaccgtctccggcaagatccggcgg
gtggaactgcgccggctcacggcggaaggcggcggcaaggagtacgtcgagggggacctg
ggatga

DBGET integrated database retrieval system