KEGG   Streptomyces venezuelae: SVEN_6093Help
Entry
SVEN_6093         CDS       T02274                                 

Definition
(RefSeq) putative uricase
  KO
K00365  
urate oxidase [EC:1.7.3.3]
Organism
sve  Streptomyces venezuelae
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SVEN_6093
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SVEN_6093
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SVEN_6093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6634774..6635697
Genome map
AA seq 307 aa AA seqDB search
MPTILGQNQYGKAENRVVKITRDGDTHHIKDLNVSVALSGDLDDVHLTGSNANCLPTDTT
KNTVFAFAKEYGIESSEQFGIHLARHFVTSQEPIKKARIRIEEYAWERIASSEANSKFIG
ADEVNHSFARKGQETRVTQITFDGEKWEVISGLKDLVVMNSTNSEFWGYIKDQYTTLQEA
YDRILATQVSARWRFNWTDDEQRMPNWERSYEQTKKHMLEAFSETYSYSLQQTLYQMATR
IINHRSEIDEVRFSLPNKHHFLVDLEPFGLKNDNEVYYAADRMYGLIEATVLRDGATAQI
PVDMTNL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgattctcggccagaaccagtacggcaaagcagagaaccgcgtcgtcaagatc
acgcgggacggcgacacccaccacatcaaggacctcaacgtctccgtcgccctctccggc
gacctcgacgacgtccacctcaccggctcgaacgccaactgcctccccaccgacacgacg
aagaacaccgtcttcgcgttcgccaaggagtacggcatcgagtcctccgagcagttcggc
atccacctcgcccgccacttcgtgacgagccaggagccgatcaagaaggcgcggatccgg
atcgaggagtacgcctgggagcgcatcgcgtcctccgaggccaactccaagttcatcggc
gccgacgaggtcaaccactccttcgcccgcaagggccaggagacccgcgtcacccagatc
accttcgacggcgagaagtgggaggtcatctccggcctcaaggacctcgtcgtcatgaac
tccaccaactcggagttctggggctacatcaaggaccagtacacgacgctccaggaggcg
tacgaccgcatcctggccacgcaggtgtccgcccggtggcggttcaactggaccgacgac
gagcagcgcatgcccaactgggagcggtcctacgagcagaccaagaagcacatgctcgag
gcgttctcggagacgtactcgtactccctccagcagacgctgtaccagatggccacgcgc
atcatcaaccaccgctcggagatcgacgaagtccgcttctcgctcccgaacaagcaccac
ttcctggtggacctggagcccttcgggctcaagaacgacaacgaggtctactacgccgcc
gaccgcatgtacggcctcatcgaggccaccgtcctccgcgacggcgccacggcgcagatc
ccggtcgacatgaccaacctctaa

DBGET integrated database retrieval system