KEGG   Streptomyces venezuelae: SVEN_6380Help
Entry
SVEN_6380         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4352
Motif
Other DBs
NCBI-ProteinID: CCA59666
UniProt: F2REY1
Position
6967798..6968079
Genome map
AA seq 93 aa AA seqDB search
MCVTVRNGSAARLDLAVVTVMARDGAGRELGQVFDATPDLGIGLAGSVAPGKRAVAAYGF
DVPPGSGSGSSVLDVEVRIGFDRPPLLWTGTAP
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtcacggtgcgcaacggctccgccgcgcggctggacctcgcggtggtgacggtc
atggcgcgggacggtgcgggccgggagctcgggcaggtcttcgacgcgacgcccgacctg
gggatcgggctcgcgggcagcgtggcgccgggaaagcgcgcggtcgccgcgtacggcttc
gacgtcccgccgggcagcgggtcggggagttccgtcctcgacgtcgaggtgaggatcggt
ttcgaccgccctccgctcctctggacggggacggctccctag

DBGET integrated database retrieval system