KEGG   Streptomyces venezuelae: SVEN_6390Help
Entry
SVEN_6390         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
  KO
K09858  SEC-C motif domain protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCA59676
UniProt: F2REZ1
Position
6975724..6976008
Genome map
AA seq 94 aa AA seqDB search
MRSRYSAFVVRDEPYLRRTWAPETRPGEIDFDPGLRWTGLEIEGTTEGTAFHQHGTVTFT
ARYVHGGEPGAMHERSRFARHEGAWVYVDGDVDA
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcccggtacagcgccttcgtcgtccgcgacgagccctatctgcggcgcacctgg
gccccggagacccggccgggcgagatcgacttcgaccccggtctgcgctggacgggcctg
gagatcgaggggaccaccgagggcaccgccttccaccagcacggcaccgtcaccttcacc
gcccgctacgtccacggcggcgagcccggcgcgatgcacgagcgcagccgcttcgcccgc
cacgagggcgcctgggtgtacgtggacggcgacgtcgacgcgtag

DBGET integrated database retrieval system