KEGG   Streptomyces venezuelae: SVEN_6395Help
Entry
SVEN_6395         CDS       T02274                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CCA59681
UniProt: F2REZ6
Position
6980022..6981053
Genome map
AA seq 343 aa AA seqDB search
MAGKAAAVELEVGDRTVRVSNPDKVYFPEPGYTKLDMVSYYLAVGDGITRALRDRPTTLE
RYPDGVTGESFFQKRAPKYLPDWIPTAHITFPSGRSADEMCPTEPAAVLWAANLGAVTFH
PWPVRRDDTDHPDELRIDLDPQPGTDYADAVRAAHELRAVLDEHGLRGWPKTSGGRGLHV
FVPILPHWTFTQVRRAAIACGRELERRMPEQVTIKWWKEERGERIFVDYNQTARDRTIAS
AYSVRPRPHAPVSAPLRWEEVDDAVPQDFDIRSMPARYAEVGDVHADMDDERFSLESLLE
LARRDEADHGLGDLPYPPEYPKMPGEPKRVQPSRAKKEPAEGE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaaggcggcagcggtggaactggaagtcggcgaccggaccgtacgcgtgtcc
aatccggacaaggtgtacttccccgaacccggctacaccaagctcgacatggtcagctac
tacctggccgtgggcgacggcatcacgcgcgccctgcgcgaccgccccaccaccctggag
cggtaccccgacggggtgaccggcgagtccttcttccagaagcgcgccccgaagtacctg
cccgactggatcccgaccgcccacatcaccttccccagcggccgctcggcggacgagatg
tgccccaccgaaccggcggccgtgctctgggccgccaacctcggcgccgtgaccttccat
ccctggccggtacgccgggacgacaccgaccatcccgacgaactccgcatcgacctcgac
ccgcagcccggcaccgactacgccgacgccgtccgcgccgcccacgaactgcgcgccgtc
ctcgacgagcacgggctgcgcggctggccgaagacatccggcggacgcgggctgcacgtc
ttcgttccgatcctgccccactggacgttcacgcaggtcaggcgggccgccatcgcctgc
ggccgggagctggaacggcggatgccggagcaggtcaccatcaagtggtggaaggaggag
cgcggcgagcggatcttcgtcgactacaaccagaccgcccgcgaccgcacgatcgcctcc
gcctactccgtacgcccgcggccgcacgcccccgtctcggcgccgctgcggtgggaggag
gtcgacgacgccgtgccgcaggacttcgacatcaggtcgatgccggcccggtacgccgag
gtcggtgacgtccacgcggacatggacgacgagcggttcagcctggagtcgctgctcgaa
ctggcccggcgggacgaggcggaccacgggctcggtgatctgccgtatccgccggagtac
ccgaagatgccgggcgagcccaagcgggtgcagccgagccgcgcgaagaaggagccggcg
gagggggagtag

DBGET integrated database retrieval system