KEGG   Streptomyces venezuelae: SVEN_6413Help
Entry
SVEN_6413         CDS       T02274                                 

Definition
Enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sve  Streptomyces venezuelae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_6413
   01212 Fatty acid metabolism
    SVEN_6413
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SVEN_6413
   00650 Butanoate metabolism
    SVEN_6413
  Lipid metabolism
   00071 Fatty acid degradation
    SVEN_6413
   01040 Biosynthesis of unsaturated fatty acids
    SVEN_6413
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SVEN_6413
   00310 Lysine degradation
    SVEN_6413
   00380 Tryptophan metabolism
    SVEN_6413
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVEN_6413
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SVEN_6413
   00281 Geraniol degradation
    SVEN_6413
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SVEN_6413
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SVEN_6413
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SVEN_6413
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SVEN_6413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6996442..6998616
Genome map
AA seq 724 aa AA seqDB search
MSESTTIRWEQDATGIVTLVLDDPNQSANTMNQAFRASIIAIADRVEAEKDSIRGIIYTS
AKKTFFAGGDLKDMVKAGPEHAQDIFEGALEMKRALRRIETLGKPVVAAINGAALGGGYE
IALASHHRVALDAPGSKIGLPEVTLGLLPGGGGVTRTVRLMGITDALLKVLLQGTQYAPR
RALDNGLVHEIAATPEEMMAKAIAFIDTHPESHQPWDVPGHRIPGGTPSNPKFAANLPAF
PANLRKQLNGAPYPAPRAIMAAAVEGSQVDFETALTIESRYFTELVIGQTAKNMIQAFFF
DLQAVNSGASRPNGIEPRPVRKVAVLGAGMMGAGIAYSCARAGIEVVLKDVSAESAAKGK
AYSEALCAKAVKRGRTTQEKADALLARITPTVEVRDLAGCDAVIEAVFEDTALKHKVFQE
IQAVVAPDALLCSNTSTLPISVLAEGVERQSDFIGLHFFSPVDKMPLVEIIKGERTGDEA
LARAFDLVRQINKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGYP
AKVLSLMDELTLTLPRKIRNETKRAIEEAGGTWTAHPGEAVIDRMVDEFGRTGRSGGAGF
YTYGEDGKRGKLWTGLREHFTKPGYEIPFRDMQERMLFAEALDTVRLLEEGVLTSVADAN
IGSIMGIGFPAWTGGILQYINGYEGGLPGFVARARELAETYGERFTPPALLLEKAERGEV
FTDA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagcaccaccatccgctgggagcaggacgcgaccgggatcgtcaccctcgtc
ctcgacgacccgaaccagtccgccaacaccatgaaccaggccttccgggcctcgatcatc
gccatcgccgaccgggtcgaggccgagaaggactccatccgcggcatcatctacacctcc
gcgaagaagaccttcttcgccggcggcgacctcaaggacatggtcaaggcgggccccgag
cacgcccaggacatcttcgaaggcgccctggagatgaagcgcgcgctgcgccgcatcgag
accctcggcaagcccgtcgtcgccgccatcaacggcgccgcgctcggcggcggctacgag
atcgccctcgcctcccaccaccgcgtcgccctcgacgcccccggctccaagatcggcctg
cccgaggtcaccctcggcctgctgccgggcggcggcggcgtcacccgcaccgtccgcctc
atgggcatcaccgacgcgctgctcaaggtgctgctccagggcacccagtacgccccgagg
cgcgccctcgacaacggcctcgtgcacgagatcgccgccacccccgaggagatgatggcc
aaggccatcgccttcatcgacacccaccccgagtcccaccagccctgggacgtccccggc
caccggatccccggcggcaccccgtcgaaccccaagttcgccgccaacctgccggccttc
ccggccaacctgcgcaagcagctgaacggcgcgccctacccggcgccgcgcgccatcatg
gccgccgccgtcgagggctcccaggtcgacttcgagaccgcgctcaccatcgagagccgc
tacttcaccgagctggtcatcgggcagacggcgaagaacatgatccaggcgttcttcttc
gacctccaggccgtcaactccggcgccagccgcccgaatggcatcgagccccggccggtc
cgcaaggtggccgtcctcggcgcgggcatgatgggcgccggaatcgcgtactcctgcgcc
cgcgccggcatcgaggtcgtcctcaaggacgtctccgccgagtccgccgccaagggcaag
gcctactccgaggcgctctgcgccaaggcggtcaagcgcggccgtacgacccaggagaag
gccgacgccctcctcgcccggatcaccccgaccgtggaggtccgcgacctggcgggctgc
gacgccgtgatcgaggcggtcttcgaggacaccgcgctgaagcacaaggtgttccaggag
atccaggcggtcgtggcgcccgacgcgctgctctgctccaacacctcgaccctgccgatc
tccgtgctcgccgagggcgtggagcggcagagcgacttcatcggcctgcacttcttctcg
ccggtcgacaagatgccgctcgtcgagatcatcaagggcgagcggacgggcgacgaggcg
ctcgcccgcgccttcgacctcgtccggcagatcaacaagacgccgatcgtcgtcaacgac
tcgcgcggcttcttcacctcccgggtgatcggccacttcatcaacgagggcgtcgccatg
gtcggcgagggcatcgagcccgcgtcggtcgagcaggcggcggcgcaggccggctacccc
gccaaggtcctctccctgatggacgagctgaccctcaccctcccgcgcaagatccgcaac
gagacgaagcgggcgatcgaggaggccggcgggacctggaccgcgcacccgggcgaggcc
gtcatcgaccggatggtcgacgagttcggccggaccggccgcagcggcggcgcgggcttc
tacacctacggggaggacggcaagcgcggaaagctctggaccggcctgcgcgagcacttc
acgaagcccgggtacgagatccccttccgcgacatgcaggagcggatgctcttcgccgag
gccctggacaccgtccggctcctggaggagggcgtcctgacctcggtcgccgacgccaac
atcggctccatcatgggcatcggcttcccggcctggacgggcggcatcctccagtacatc
aacggctacgagggcgggctccccggcttcgtcgcccgcgcgcgcgagctggcggagacc
tacggcgagcggttcaccccgcccgcgctcctgctggagaaggcggagcggggcgaggtc
ttcacggacgcctga

DBGET integrated database retrieval system