KEGG   Streptomyces venezuelae: SVEN_6424Help
Entry
SVEN_6424         CDS       T02274                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_22 MMR_HSR1 AAA_23 AAA_30 AAA_33 RsgA_GTPase AAA_18 AAA_16 AAA_28 Dynamin_N Viral_helicase1 ArgK ABC_tran_Xtn AAA_27 cobW NACHT Zeta_toxin MukB FtsK_SpoIIIE NTPase_1 DUF3584 AAA_25 DUF87
Motif
Other DBs
NCBI-ProteinID: CCA59710
UniProt: F2RF25
Position
7009092..7010759
Genome map
AA seq 555 aa AA seqDB search
MRASPRIHPLMTATLVAKDLAAGHGERTLFAQLDLVVAPGDVIGLVGVNGAGKSTLLRLL
AGLDTPEEGELRLSPPTAAVGHLPQEPERRAGETVREFLARRTGVAAAQAAMDEATQGLV
DGTPGADDAYATTLERWLNLGGADLDERAEEVAGSLGLTVGLDQPMTSLSGGQAARAGLA
SLLLSRYDVFLLDEPTNDLDLDGLERLEAFVKGLRAGTVVISHDREFLTRTVTKVLELDL
AQQQITLYGGGYESYLEERDRARRHAREDYEEYAGKKAALEARGHMQRSWMDKGVRNARR
KSTDGDKLGRNARSEASEKQAAKARQTQRMIERLDVVDEPRKEWELRMEIAAAPRSGSVV
ATLREAEVRRGDFSFGPVTLQIDWADRVAVTGANGAGKSTLLAALLGRLPLDSGDAVLGS
GVVVGEVDQARKLFHGTESLLEAFCAAVPETEPAEVRTLLAKFGLKAVHVMRPATTLSPG
ERTRAALALLQGRGVNLLVLDEPTNHLDLPAIEQLESALESYNGTLLLVTHDRRMLDAVR
TTRRVEVADGKVTEL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcgtcgcctaggattcatcccctgatgactgcaaccctcgtcgccaaggacctc
gccgccggccacggcgaacgcaccctcttcgcccagctcgacctggtcgtcgcccccggc
gacgtcatcggcctcgtcggcgtcaacggcgccggcaagtcgaccctgctgcggctgctc
gccgggctcgacaccccggaggagggcgagctccggctctccccgcccaccgccgccgtc
ggccacctcccgcaggagccggagcgccgcgcgggcgagaccgtgcgcgagttcctcgcc
cggcgcaccggcgtcgccgccgcccaggcggcgatggacgaggccacccagggcctcgtc
gacggcacgcccggcgccgacgacgcgtacgccaccaccctggagcgctggctgaacctc
ggcggcgccgacctcgacgagcgcgccgaggaggtcgcgggctccctcggcctcaccgtc
ggcctcgaccagccgatgacctccctctccggcggccaggccgcccgcgcgggactcgcc
tccctgctgctctcccgctacgacgtcttcctgctcgacgagcccacgaacgacctcgac
ctcgacggtctggagcgcctcgaagccttcgtgaaggggctgcgcgccgggacggtcgtc
atcagccacgaccgcgagttcctcacccggaccgtcaccaaggtcctcgaactcgacctc
gcccagcagcagatcacgctgtacggcggcggttacgagtcctacctggaggagcgggac
cgggccaggcggcacgcgcgcgaggactacgaggagtacgccgggaagaaggcggccctc
gaagcccgcggccacatgcagcggtcctggatggacaagggcgtcaggaacgcccgccgc
aagtccaccgacggcgacaagctcggacgcaacgcgcgcagcgaggccagcgagaagcag
gccgcgaaggcccgccagacccagcgcatgatcgagcgcctcgacgtcgtcgacgagccc
cgcaaggagtgggagctgcggatggagatcgcggccgcgccgcgctccggctcggtcgtc
gccaccctgcgcgaggcggaggtgcgccgcggcgacttctccttcggccccgtcaccctc
cagatcgactgggccgaccgcgtcgccgtcaccggtgccaacggcgctgggaagtcgacc
ctgctcgccgcgctcctcggccggctgccgctggactccggcgacgcggtcctcggctcg
ggcgtcgtcgtcggcgaggtcgaccaggcgcgcaagctcttccacggcacggagagcctc
ctggaggcgttctgcgcggccgtgccggagaccgagcccgccgaggtccgcaccctgctc
gccaagttcggactcaaggccgtccacgtgatgcgccccgccaccaccctctccccgggc
gagcggacccgcgccgcgctcgccctgctccagggccgcggggtgaacctgctggtgctc
gacgagccgaccaaccacctggacctgccggccatcgagcagctggagtccgcgctggag
tcgtacaacggcaccctgctgctcgtcacgcacgaccgtcggatgctggacgcggtgcgc
accacccgccgcgtcgaggtcgccgacggcaaggtcaccgagctctga

DBGET integrated database retrieval system