KEGG   Streptomyces venezuelae: SVEN_6431Help
Entry
SVEN_6431         CDS       T02274                                 

Definition
(GenBank) ThiJ or PfpI family protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI DUF2069
Motif
Other DBs
NCBI-ProteinID: CCA59717
UniProt: F2RF32
Position
7017198..7017842
Genome map
AA seq 214 aa AA seqDB search
MQIAVLLYQGFTTLDAVGPYELLARLPGAETVFVAKEAGPVRNDQGSLALVADKALAEVP
RPDIVLVPGGPDSRAAMDDPEIQAWLRTADETSTWTTSVCTGSLILAAAGVLDGRRATTH
WLAHEELRALGVEPTGERVVFDGKYVTAAGVSSGIDMALHLLGRIGGDETAQTIQLLTEY
DPQPPYDAGSPDKAPAEIVARWRGVKAEDLPQGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgccgtcctgctctaccagggcttcaccacgctcgacgccgtcggtccgtac
gagctcctcgcccggctccccggggccgagaccgtcttcgtggccaaggaggcaggaccc
gtccgcaacgaccagggcagcctcgccctcgtcgccgacaaggccctcgccgaggtcccg
cgccccgacatcgtcctggtccccggcggccccgactcccgcgcggcgatggacgacccg
gagatccaggcctggctccgcaccgccgacgagaccagcacctggaccacctccgtctgc
accggctccctgatcctggccgccgccggagtcctcgacggccgccgcgccaccacccac
tggctggcccacgaggagctcagggcgctcggcgtcgaacccaccggcgaacgggtcgtc
ttcgacggcaagtacgtcaccgccgccggcgtctcctccggcatcgacatggcgctgcac
ctgctcggccggatcggcggggacgagaccgcgcagacgatccagctgctcaccgagtac
gacccgcagccgccctacgacgcgggctcaccggacaaggccccggccgagatcgtggcg
cggtggcggggcgtgaaggcggaggacctgccgcagggccgctga

DBGET integrated database retrieval system