KEGG   Streptomyces venezuelae: SVEN_6470Help
Entry
SVEN_6470         CDS       T02274                                 

Definition
(GenBank) sensor histidine kinase
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c
Motif
Other DBs
NCBI-ProteinID: CCA59756
UniProt: F2RG36
Position
7060744..7062756
Genome map
AA seq 670 aa AA seqDB search
MSQLRAPASRSDRREGGRHGRSGARPAPGTSSKPPTPAAAPHPTEARIRPQLLRTSVLPA
VAVALGGAAAVLFTLRSTGATPTPGLWAALTGAAALTVASVTAAALGADRAAKAVVDRCN
ALRRTTARGQNELLTVVEQLRKGEAVPPRPALPAGSASGDEFDLLSQELTRSHEAAVAAV
VQASQLSSSVGNEQKVEVFVNLARRLQSLVHREIQLLDELENEVEDPELLKGLFHVDHLA
TRIRRHAENLAVLGGAIARRQWSNPVTMTEVLRSSIAEVEQYPRVKLVPPIDGTLRGHAV
ADVIHLLAELVENATLFSAPHTTVLLRAQYVTAGLAIEVEDRGLGMPVTEQNKMNALLAD
PDQVNVAHLLQDGRIGLFVVSALARRHGIAVRLQSNIYGGVQAVLVLPQGLLGADPEGLA
QHERQTAATAGSAAVPPNQVQMQPQPTTRTPAHPPSQPAPSQPAPGGTTPLHTPAQAPAP
APHAAPHATPAPAAHPQAPVPVPVAMNTQAAMSAPAGMSAPVAANTQAAPAPVPQPVASP
ERTPVRHEETSAPGPHTHPRTTERPDGYPDSGRHTSAPVRPAAAEHTVPPASYLSPLPPA
PEDNGRPVLPKRRAQEHIVPQLRDEPVARKPEEHALHDPGLMAAFQRGIGLAESQPAPHE
SLRPGDAHKE
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacttcgcgcacccgcctcgcggtccgatcgacgcgagggcgggcggcacggc
cggtcaggcgcccgccccgcccccggtaccagcagcaaaccccccaccccggccgccgcc
ccgcacccgacggaagcgcggatacggccccagctcctgcgcacctccgtacttcccgcc
gtcgcggtcgcactgggcggcgccgccgccgtcctcttcaccctccgctccaccggagcc
acccccacgcccggcctctgggccgcgctcaccggcgccgccgccctcacggtcgcctcc
gtgacggccgccgcgctcggtgcggaccgggccgccaaggcggtcgtcgaccggtgcaac
gccctgcgccgcacgaccgcccggggccagaacgaactgctcacggtcgtcgaacagttg
cgcaagggggaggcggtcccgccccggcccgcactgccggccggctccgcgtccggcgac
gagttcgacctgctctcccaggagctgacccgctcccacgaggccgccgtcgcggccgtc
gtgcaggcgtcccagctctccagcagcgtcggcaacgaacagaaggtcgaggtcttcgtc
aacctcgcccggcgcctccagtccctggtgcaccgagagatccagctcctggacgaactg
gagaacgaggtcgaggacccggagctgctcaagggcctcttccacgtcgaccacctggcc
acccgcatccgccgtcacgccgagaacctcgccgtgctcggcggcgccatcgcccgccgc
cagtggtcgaacccggtcaccatgaccgaggtgctgcgctcctcgatcgccgaggtcgag
cagtacccgcgcgtcaagctcgtcccgccgatcgacggtacgctccggggccatgccgtg
gccgacgtcatccacctcctcgccgaactcgtcgagaacgccacgctgttctccgcaccg
cacaccacggtgctgctccgcgcccagtacgtcacggccggactcgccatcgaggtcgag
gaccgcgggctcggcatgcccgtcaccgagcagaacaagatgaacgccctgctcgccgac
cccgaccaggtgaacgtcgcgcacctgctccaggacggccgcatcggactcttcgtcgtc
tcggccctcgcccgccgccacggaatcgccgtacgcctccagtccaacatctacggcgga
gtccaggccgtcctcgtcctgccgcagggcctcctcggcgccgaccccgagggcctcgcc
cagcacgagcgccagaccgccgcgacggccggctcggccgcggtcccgccgaaccaggtg
cagatgcagccccagccgacgacgcggacgccggcgcacccgccgtcccagcccgcgccg
tcccagcccgcgccggggggcacgacccccctgcacaccccggcccaggcccccgcaccg
gcgccccacgcggcgccccacgcgactccggcacccgccgcccacccccaggcgcccgtg
cccgtgccggtcgcgatgaacacgcaggcggccatgagcgcgccggcgggcatgagcgcg
ccggtcgcggcgaacacgcaggccgcccccgcacccgtaccgcagcccgtggcgtccccc
gagcggacccccgtccgccacgaggagacctccgcccccggcccgcacacccacccccgt
acgaccgaacgcccggacggatacccggactccggtcgccacacctcggcaccggtccgg
ccggccgctgccgagcacacggtcccgccggcctcctacctgtcgccgctccccccggcg
cccgaggacaacggccggcccgtgctccccaagcggcgcgcccaggagcacatcgtcccg
cagctgcgcgacgagcccgtggcccgcaagcccgaggagcacgccctgcacgaccccggc
ttgatggccgcgttccagcgcggcatcggtctcgccgagtcccagcccgccccccatgaa
tcgctgcgtccaggcgacgcgcacaaggagtag

DBGET integrated database retrieval system