KEGG   Streptomyces venezuelae: SVEN_6471Help
Entry
SVEN_6471         CDS       T02274                                 

Definition
(GenBank) multi-component regulatory system-3, containing roadblock or LC7 domain
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Robl_LC7
Motif
Other DBs
NCBI-ProteinID: CCA59757
UniProt: F2RG37
Position
7062762..7063196
Genome map
AA seq 144 aa AA seqDB search
MASNVPPGHSSDLDWLLSGLVQRVPYTRNAVLLSSDGLVKSVHGLDPDAADHMAALASGL
YSLGRSAGARFGDGGEVRQVVVELDSTLLFVSTAGSGTCLAVLAGREADAAVLGYEMAML
VKSVRPYLVTPARQAAGVVGGLGQ
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaatgtgccccccggccattcctcggacctcgactggctgctgagcggactg
gtccagcgggtcccgtacacccgcaacgcggttctgctctcctccgacggcctcgtcaaa
tccgtccacggcctcgaccccgacgccgccgaccacatggccgccctcgcctccggcctg
tactcgctcggccgcagcgcgggcgcccggttcggcgacggcggtgaggtgcgccaggtg
gtcgtcgagctcgactccaccctcctgttcgtctccaccgccggctccggcacctgcctc
gcggtgctcgccggacgcgaggcggacgccgcggtcctcgggtacgagatggcgatgctc
gtcaagagcgtccggccgtacctggtcacccccgcccggcaggcagccggtgtggtgggt
ggcctcggacagtga

DBGET integrated database retrieval system