KEGG   Streptomyces venezuelae: SVEN_6473Help
Entry
SVEN_6473         CDS       T02274                                 

Definition
(GenBank) putative ATP or GTP-binding protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_1 GTP_EFTU AAA_16 Ras MMR_HSR1 Roc T2SSE AAA_29 AAA_18 AAA_28 AAA_24
Motif
Other DBs
NCBI-ProteinID: CCA59759
UniProt: F2RG39
Position
7063548..7064171
Genome map
AA seq 207 aa AA seqDB search
MAYDSGSERHDSFATDPFPTALKILVAGGFGVGKTTLVGAVSEIEPLSTEELLTSVSAAT
DSLEGVESKSTTTVAMDFGRITLDDRHVLYLFGTPGQERFWFMWDELSEGALGAVVLADT
RRLQDCFSAVDFFERRGIRFVVAVNEFDGSFRYEPDEVRAALDLKPEVPVVTCDARISSS
GIRTLLTLVQHLLTTIPAAVPSYGATP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgacagcggctctgagcgccacgacagtttcgcgaccgaccccttccccacc
gcgctcaagatcctggtggcgggcggattcggcgtgggcaagacgaccctcgtgggtgcg
gtcagcgagatcgaaccactgagcaccgaagagctgctgacctcggtcagcgcggccacg
gacagcctggagggcgtggagtccaagtcgacgaccaccgtcgccatggacttcggccgc
atcacgctcgacgaccgccacgtgctctacctcttcggcacccccggccaggagcgcttc
tggttcatgtgggacgaactctccgagggcgcgctcggggcggtcgtcctcgccgacacc
cgcaggctccaggactgcttctccgccgtggacttcttcgagcggcggggcatccggttc
gtcgtggcggtcaacgagttcgacggctcgttccgctacgagcccgacgaggtccgggcc
gcgctcgacctcaagccggaggtccccgtcgtcacctgcgacgcccggatctccagctcc
ggcatccgcaccctgctgacgctcgtccagcacctgctcaccaccatcccggccgccgtg
ccgagctacggagccacgccatga

DBGET integrated database retrieval system