KEGG   Streptomyces venezuelae: SVEN_6482Help
Entry
SVEN_6482         CDS       T02274                                 

Definition
(GenBank) membrane translocator
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase LANC_like APH Choline_kinase RIO1 Kdo
Motif
Other DBs
NCBI-ProteinID: CCA59768
UniProt: F2RG48
Position
complement(7073116..7075743)
Genome map
AA seq 875 aa AA seqDB search
MNKGYAVFCDADRHFYDAPHRLVFAEGAGGSLYRAATLPVPEGWTSHRRGDWLALRPLDL
SLPSQGWKIHVSACLDNAEAILATVRAYCLEHGVAFKFVPSRYLLHQRNAKYADRSASGK
FITVYPADDEQCERVATDLAELLEGRPGPYILSDLRWGRGPVHLRYGSFTLRHCYDEHGE
LRAAVEDGSGTLVPDRRDPVFHVPDWVTPPAFLRPHLEARASVTVQDMPYDIEKALHFSN
GGGVYEARDRRTGRRVVLKEARPYAGLAADGADAVTRLHREREALERLSGLACTPEVLGG
FTVGDHHFLALEFVDGKPLNTFFARRHPLMEAAPSAERLAEYTEWALRIHRLVERAVAAV
HERGIVFNDLHLFNIMVSEDESSVTLLDFEAARPAAEGGRQTVANPAFVAPADRRGVDVD
RYALACLRIALFIPLTSLLAVDRGKAAHLAETAAARFPLPPGFLDEAVREITRDPAGGRP
GGSSRAPDRAEGRSRFLPAEPGDWPNSRDSMVAAILASATPEREDRFFPGDIAQFATAGG
GMTVGHGTAGVLHALHESGAPRCPEAEDRLLQHAKQPDSGTPLGFYDGLAGVAWTLERLG
HPAAALELASLVAEQDHEALAPDLYGGTAGVGLALDALAVATGESGLHTAALRCAELSAR
PLRAPARPAGAAGKARTGLLHGSAGRALLFIRLYERTGDTALLDLAAEALHDDLSRCVRG
ASGTLQVDEGWRTMPYLGAGSVGIGMVIDDYLLHRRDDDLDRARQEIVRAAQATFYAQPG
LFRGVAGMVLHLARTNVGGPGTTPEDVRRQVGCLSWHAMAYQGRLAFPGEQMMRLSMDLS
TGTAGVLLALASALGDRPAHLPFLPPLPRPHEPAP
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaggggtacgcggtgttctgcgacgccgaccgtcacttctacgacgcgccgcac
cgtctggtcttcgccgagggagccggcggctccctctaccgggcggccaccctccccgta
cccgagggatggacgtcccaccgcaggggcgactggctcgccctgcgccccctggacctg
tcgctcccttcgcagggctggaagatccacgtctcggcctgtctcgacaacgcggaggcg
atcctcgccacggtccgcgcgtactgtctggaacacggcgtggccttcaagttcgtcccc
agccgctatctgctgcaccagcgcaacgccaagtacgcggaccgctcggcgagcggcaag
ttcatcaccgtgtatccggccgacgacgagcagtgcgagcgcgtggccaccgatctggcg
gagctgctggagggccggccggggccgtacattctcagcgatctgcgctggggccggggc
cccgtgcacctgcggtacggcagcttcaccctccgccactgctacgacgagcacggggag
ctgcgggcggccgtcgaggacgggtccggcacgctcgtacccgaccggcgcgaccccgtc
ttccacgtgcccgactgggtgactccccccgccttcctgcgtccgcacctggaggccagg
gcctcggtgaccgtccaggacatgccgtacgacatcgagaaggccctgcacttctccaac
ggcggcggcgtgtacgaggcccgggaccggcggaccgggcggcgggtcgtcctgaaggag
gcgcggccgtacgccggcctcgccgccgacggcgcggacgccgtgacgaggctgcaccgc
gaacgcgaagccctggaacggctctcggggctcgcctgcacgccggaggtcctcggcggc
ttcacggtgggcgaccaccacttcctggccctggagttcgtggacggcaagccgctcaac
accttcttcgcgcggaggcatccgctgatggaggccgctccgtcggcggagcggctcgcc
gagtacacggagtgggcgctgcgcatccaccggctcgtcgagcgggccgtggccgcggtg
cacgagcgcgggatcgtcttcaacgacctgcatctgttcaacatcatggtgtccgaggac
gagtcctcggtgacgctgctggacttcgaggcggcccggcccgccgcggagggcggtcgc
cagaccgtcgccaacccggcgttcgtggcccccgccgaccggcggggcgtcgatgtggac
cggtacgccctcgcgtgcctccggatcgcgctgttcatcccgctcaccagcctgctggcg
gtggaccggggcaaggccgcgcacctggcggagaccgcggcggcgcgcttcccgctgccg
cccggttttctggacgaggcggttcgggagatcacccgcgacccggccggcggccggccc
ggcgggagctcgcgggcgcccgaccgtgcggagggccgctcccggttcctgcccgcggag
ccgggcgactggccgaacagccgtgactccatggtggccgcgatcctggcctcggcgacg
cccgagagggaggatcgtttcttccccggggacatcgcgcagttcgccacggccggcggg
ggcatgaccgtcggacacggcaccgccggagtgctccacgccctgcacgagagcggtgca
ccccgatgtccggaggccgaggacagactcctgcagcacgccaaacaacccgactccggc
acaccactcggcttctacgacgggctcgccggtgtcgcctggaccctcgaacggctcggg
cacccggccgccgccctcgaactggcctcactcgtcgccgaacaggaccacgaggccctc
gcccccgacctgtacggagggacggccggcgtcggcctcgccctggacgccctggccgtc
gccaccggtgaaagcggcctccacaccgcggccctgcgctgcgccgagctgtccgcccga
ccgctccgggcgcccgcccgaccggcgggagcggcaggcaaggcgcgcacgggactcctg
cacggctccgccggacgtgccctcctgttcatacggctctacgagcgcaccggggacacc
gccctcctcgacctcgccgccgaggcactccacgacgacctgagccgctgcgtccgcggc
gcctccgggaccctgcaggtcgacgagggctggcgcaccatgccgtacctcggcgcgggc
agcgtgggcatcggcatggtgatcgacgactacctgctccaccggcgcgacgacgacctg
gaccgggcgcgccaagagatcgtgcgggcggcgcaggccaccttctacgcccagcccggt
ctcttccggggcgtcgcggggatggtgctccacctcgcccgtacgaacgtcggcggtccc
ggtacgacaccggaggacgtacgtcgccaggtcggctgcctgagctggcacgccatggcc
taccagggccgtctcgccttccccggcgagcagatgatgcgcctgtccatggacctctcc
acgggcacggcgggcgtcctgctcgcccttgcctcggccctgggcgaccgcccggcccac
ctgcccttccttccgccgcttccgcggccccacgaaccggccccgtga

DBGET integrated database retrieval system