KEGG   Streptomyces venezuelae: SVEN_6495Help
Entry
SVEN_6495         CDS       T02274                                 

Definition
(GenBank) regulatory protein, LysR:LysR_
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 MarR_2 HTH_20
Motif
Other DBs
NCBI-ProteinID: CCA59781
UniProt: F2RG61
Position
7090418..7091332
Genome map
AA seq 304 aa AA seqDB search
MFDLHRLRLLRELKHRGTLAAVAAALSYAPSSVSQQLSQLEAEVGVPLLEPVGRRVRLTA
QAEILVAHTEAVLERLERAEADIATSLTDLTGTLRIAAFQTAALALLPVALGLLRDLHPR
LRVHVTQMEPERALPALQARDFDLVLAEEYPGNPNPRLAELEQEDLLDDPLRLALPGPAD
GADGPLAALRSLAGHPWAMEPEGTTARHWAVTLCRSAGFEPDVRFETTDLLLHLRLVEQG
HAAAFLPELVWSGRRPTVPLRQLPRGQRSRRVFTVVRRGRSRHPAVLACRAALLRAAATS
SGKG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatctgcaccggctgcgcctgctgcgcgaactcaagcaccgcggcacgctcgcg
gccgtcgccgccgccctgtcctacgccccctcctccgtctcccagcagctctcacagctg
gaggccgaagtcggcgtcccactgctggaaccggtcgggcgacgggtgcggctgaccgcg
caggccgagatcctcgtcgcacacaccgaagcggtgctcgaacggctcgagcgcgccgag
gcggacatcgccacctccctcaccgacctcaccggcaccctgcgcatcgccgcgttccag
acggccgcgctggccctgctcccggtcgccctcggtctgctgcgcgacctgcacccgcgg
ctgcgcgtccacgtcacacagatggagccggaacgggccctgcccgccctgcaggcccgt
gacttcgacctggtcctcgccgaggagtaccccggcaaccccaacccccggctcgccgaa
ctcgagcaggaggacctgctcgacgaccccctccgcctcgccctgcccgggcccgccgac
ggcgccgacggccccctggcggcattgcgctcgctggccggtcatccctgggcgatggag
cccgagggcacgaccgcccggcactgggccgtgacgctctgccgcagcgccggcttcgaa
cccgacgtacggttcgagaccaccgacctgctgctccacctccgcctggtcgagcagggg
cacgccgccgccttcctccccgaactggtctggagcggccggcggccgaccgtccccctg
cggcagctgccccggggacagcgctcccgccgcgtgttcaccgtcgtacgccgcggccgc
agccggcacccggcggtcctggcctgccgggcggccctcctccgggcggctgccacgtcg
tccgggaaggggtag

DBGET integrated database retrieval system