KEGG   Streptomyces venezuelae: SVEN_6496Help
Entry
SVEN_6496         CDS       T02274                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4246 2OG-FeII_Oxy_5
Motif
Other DBs
NCBI-ProteinID: CCA59782
UniProt: F2RG62
Position
7091540..7092952
Genome map
AA seq 470 aa AA seqDB search
MMECSAHIRAKPGWFDKMNDADIVARWTREAVAQGLTEAQVRYVLDELAHYAALRDERTG
IEVSGVDGVWHSDALVEDELRSRLRAAVRVLEEVPEAELDWHPGSDGQVLDLVHPSLFCL
VREASGAPERAWQNPTNHYSKYEFSERFQWLPTDVDVDAEGEVAFRSYVNNLHPETHREL
ASVLPELLARFRPLLENVLTDLRNPRPPRIDVDPYGWYDDEPQRPDRSDYEDDQAYNEAC
RLQERALDDWWENRRPVVPDAPAFSAPEPPERIDLRGRRLQVIVKLATIHLTPDKPEYAG
GSWHVEGMLNERIVSTGIYYWDNENITESRLGFRAALDDPEYEQSDDNGVREVYGLENED
ALNQMLGSVSTPEGRCLAFPNILQHRVSPFRLADPTRPGHRKILAFFLVDPARTIVSTSD
VPPQQPWSDTSTMTLEQAKEYREQLMRERKFFVDEHNEQLYEREFSLCEH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatggagtgcagcgcacacatccgggcgaagccgggatggttcgacaagatgaacgac
gccgacatcgtcgccaggtggacgcgggaggcggtcgcccaggggctgaccgaggcacag
gtgcgttacgtgctggacgaactcgcgcactacgccgcgctgcgggacgagcgcacgggg
atcgaggtgtccggcgtcgacggagtgtggcactccgacgccctggtcgaggacgagctc
aggtcccggctgcgcgcggccgtacgggtactggaggaagtgcccgaggcggagctcgac
tggcatcccggctccgacgggcaggtgctggacctggtgcacccctccctgttctgtctg
gtgagggaggcgagcggcgcgcccgagcgcgcttggcagaatccgacgaaccactactcc
aagtacgagttctcggagcggttccaatggctgcccacggatgtcgacgtcgacgccgag
ggcgaggtcgccttccgttcgtacgtcaacaacctccatcccgagacccatcgcgagctg
gcctccgtcctgcccgaactgcttgcgcgcttccgcccgctgctggagaacgtgctcacc
gatctgcgcaacccgcggcccccgcggatcgacgtcgacccttacgggtggtacgacgac
gagccgcagcgtcccgacaggtcggactacgaggacgaccaggcctacaacgaggcctgt
cggctgcaggagcgggccctggacgactggtgggagaaccggcgccccgtggtcccggac
gcaccggccttctccgcacccgagccgccggagcggatcgacctgcgcggtcgtcgcctc
caggtcatcgtcaagctcgccaccatccatctcaccccggacaagcccgagtacgccggt
ggttcctggcacgtcgaggggatgctgaacgagcggatcgtctcgaccggcatctactac
tgggacaacgagaacatcaccgagagccggcttggcttccgggccgcgctcgacgacccg
gagtacgagcagagcgacgacaacggtgtgcgtgaggtctacggcctggagaacgaggac
gcgctgaaccagatgttgggttcggtgtcgacgccggaaggccgctgcctggcgttcccg
aacatcctgcagcaccgcgtgagcccgttccgcctcgcggaccccacccggccgggacac
cgcaagatcctcgcgttcttcctggtggacccggcgcggacgatcgtctcgacgtccgac
gtgccgcctcagcagccgtggtccgacacctcgacgatgacgctggagcaggccaaggag
taccgcgaacagctcatgcgggaacgcaagttcttcgtggacgagcacaacgagcagctc
tacgagcgggagttctccctctgcgagcactga

DBGET integrated database retrieval system