KEGG   Streptomyces venezuelae: SVEN_6504Help
Entry
SVEN_6504         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUKH_6 SMI1_KNR4 SUKH_5
Motif
Other DBs
NCBI-ProteinID: CCA59790
UniProt: F2RG70
Position
7107960..7108514
Genome map
AA seq 184 aa AA seqDB search
MHPDVEQLTRIVPPPADRRPRAWTDVEARLGTALPEDFKDLVDTYGGGVFDETIWILEPD
CADPDYDLLAMKEERAEVLARLWEIGPEPRPEQLEADGAGLLPFAYIEGTGAYLYWFTGK
DVRPEDWTVLANAGRGPEWEYHPVPSTRFVLSVLTGEIHSDILDNLPVDDEDHSFDPNDE
ILGG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctgacgtggaacagctcacccggatcgtcccgccgccggcggaccgtcggccg
cgggcctggacagacgtcgaggcccgcctgggcaccgccctgcccgaggacttcaaggac
ctcgtcgacacctacggcggcggtgtcttcgacgagacgatctggatcctcgaacccgac
tgcgccgaccccgactacgacctcctcgccatgaaggaggagcgcgccgaggtgctggcc
cggctgtgggagatcggccccgagccgcgccccgagcagctggaggccgacggggccggg
ctgctgcccttcgcgtacatcgaggggaccggcgcctatctctactggttcacgggcaag
gacgtccgccccgaggactggacggtcctggcgaacgcgggccgtggaccggagtgggag
taccacccggtgccgagcacccggttcgtcctgtccgtgctcaccggcgagatccactcc
gacatcctcgacaacctgcccgtcgacgacgaggaccacagcttcgacccgaacgacgag
atcctgggcgggtga

DBGET integrated database retrieval system