KEGG   Streptomyces venezuelae: SVEN_6617Help
Entry
SVEN_6617         CDS       T02274                                 

Definition
putative secreted pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sve  Streptomyces venezuelae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sve00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sve00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7232025..7233164)
Genome map
AA seq 379 aa AA seqDB search
MPSHPTGAVPGRRSLLLGAAGAALALALPAAPASAASPSPARPFGRFGSPARRLTERTLY
VHQGGLGDHTTVQAAVTAAGGTGWTLVLAPGTYRETVSVTSARTDMTWIGASGDPRDVVV
VYANAAGTPRPEGGTHGTTGSATTTVQAAGFTAHAVSFANDFLRTDLPGNPGTQAVALKV
QGDRSAFFHCRFLGHQDTLYADSMALSAFARQYFAHCYVEGDVDFVFGRATAVFEHCHFR
TLLRPDLAAAPHGFVFAPSTARENPYGFLAVRCRVTSEAPDGFYKLARPWVPGSDLTARP
SLVVRESVLGPGIDAVAPYANMRDAHPWQAQRFAEHHNSGPGARITVPENRPQLGPTEAA
STTRSTYLGNWNPVPTRPS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcaccccaccggagccgtcccgggacgccgctccctgctcctgggcgccgcc
ggagcggcgctcgccctcgcgctgcccgccgcccccgcctcggcggcctccccgtcgccg
gcccggcccttcggccggttcggttcgcccgcccgccggctcaccgagcggaccctgtac
gtgcaccaggggggcctcggggaccacacgaccgtccaggcggcggtcaccgccgcgggc
ggcaccggctggaccctggtgctcgccccggggacgtaccgggagaccgtctccgtgacc
tccgcccgtacggacatgacctggatcggcgcgagcggcgacccccgggacgtcgtcgtg
gtgtacgccaacgcggccgggacaccgcgccccgagggcggcacccacggcaccacgggc
tccgccacgaccaccgtccaggcggccggcttcaccgcgcacgccgtctccttcgccaac
gacttcctccgcaccgacctgccaggcaaccccggcacccaggccgtcgcgcttaaggtg
cagggcgaccggtcggccttcttccactgccgcttcctcggccaccaggacaccctgtac
gccgactccatggcgctctcggccttcgcccgccagtacttcgcgcactgttacgtcgag
ggcgacgtcgacttcgtcttcggccgggccaccgccgtcttcgagcactgccacttccgt
acgctgctccgcccggacctggcggcggccccgcacggcttcgtcttcgcgccgtcgacg
gcccgggagaacccgtacggcttcctggccgtccgctgccgggtcaccagtgaagccccg
gacggcttctacaagctggcccggccctgggtacccggctcggacctcacggcccggccg
tcgctcgtggtccgggagagcgtcctcggcccggggatcgacgccgtcgccccgtacgcg
aacatgcgcgacgcccatccgtggcaggcacaacgcttcgccgaacaccacaactccggc
ccgggcgcccggatcacggtcccggagaaccgcccccaactcggcccgaccgaggccgcg
tccacaacccggtccacgtacctgggcaactggaacccggtcccgacccgaccctcctga

DBGET integrated database retrieval system