KEGG   Streptomyces venezuelae: SVEN_6617Help
Entry
SVEN_6617         CDS       T02274                                 

Definition
putative secreted pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sve  Streptomyces venezuelae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SVEN_6617
   00500 Starch and sucrose metabolism
    SVEN_6617
Enzymes [BR:sve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SVEN_6617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7232025..7233164)
Genome map
AA seq 379 aa AA seqDB search
MPSHPTGAVPGRRSLLLGAAGAALALALPAAPASAASPSPARPFGRFGSPARRLTERTLY
VHQGGLGDHTTVQAAVTAAGGTGWTLVLAPGTYRETVSVTSARTDMTWIGASGDPRDVVV
VYANAAGTPRPEGGTHGTTGSATTTVQAAGFTAHAVSFANDFLRTDLPGNPGTQAVALKV
QGDRSAFFHCRFLGHQDTLYADSMALSAFARQYFAHCYVEGDVDFVFGRATAVFEHCHFR
TLLRPDLAAAPHGFVFAPSTARENPYGFLAVRCRVTSEAPDGFYKLARPWVPGSDLTARP
SLVVRESVLGPGIDAVAPYANMRDAHPWQAQRFAEHHNSGPGARITVPENRPQLGPTEAA
STTRSTYLGNWNPVPTRPS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcaccccaccggagccgtcccgggacgccgctccctgctcctgggcgccgcc
ggagcggcgctcgccctcgcgctgcccgccgcccccgcctcggcggcctccccgtcgccg
gcccggcccttcggccggttcggttcgcccgcccgccggctcaccgagcggaccctgtac
gtgcaccaggggggcctcggggaccacacgaccgtccaggcggcggtcaccgccgcgggc
ggcaccggctggaccctggtgctcgccccggggacgtaccgggagaccgtctccgtgacc
tccgcccgtacggacatgacctggatcggcgcgagcggcgacccccgggacgtcgtcgtg
gtgtacgccaacgcggccgggacaccgcgccccgagggcggcacccacggcaccacgggc
tccgccacgaccaccgtccaggcggccggcttcaccgcgcacgccgtctccttcgccaac
gacttcctccgcaccgacctgccaggcaaccccggcacccaggccgtcgcgcttaaggtg
cagggcgaccggtcggccttcttccactgccgcttcctcggccaccaggacaccctgtac
gccgactccatggcgctctcggccttcgcccgccagtacttcgcgcactgttacgtcgag
ggcgacgtcgacttcgtcttcggccgggccaccgccgtcttcgagcactgccacttccgt
acgctgctccgcccggacctggcggcggccccgcacggcttcgtcttcgcgccgtcgacg
gcccgggagaacccgtacggcttcctggccgtccgctgccgggtcaccagtgaagccccg
gacggcttctacaagctggcccggccctgggtacccggctcggacctcacggcccggccg
tcgctcgtggtccgggagagcgtcctcggcccggggatcgacgccgtcgccccgtacgcg
aacatgcgcgacgcccatccgtggcaggcacaacgcttcgccgaacaccacaactccggc
ccgggcgcccggatcacggtcccggagaaccgcccccaactcggcccgaccgaggccgcg
tccacaacccggtccacgtacctgggcaactggaacccggtcccgacccgaccctcctga

DBGET integrated database retrieval system